Recombinant Human SLC19A1 protein, His&Myc-tagged
Cat.No. : | SLC19A1-4242H |
Product Overview : | Recombinant Human SLC19A1 protein(P41440)(420-591aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 420-591aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 25.5 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | DVRGLGLPVRKQFQLYSVYFLILSIIYFLGAMLDGLRHCQRGHHPRQPPAQGLRSAAEEKAAQALSVQDKGLGGLQPAQSPPLSPEDSLGAVGPASLEQRQSDPYLAQAPAPQAAEFLSPVTTPSPCTLCSAQASGPEAADETCPQLAVHPPGVSKLGLQCLPSDGVQNVNQ |
Gene Name | SLC19A1 solute carrier family 19 (folate transporter), member 1 [ Homo sapiens ] |
Official Symbol | SLC19A1 |
Synonyms | SLC19A1; solute carrier family 19 (folate transporter), member 1; folate transporter 1; FOLT; RFC; IFC-1; intestinal folate carrier 1; placental folate transporter; reduced folate carrier protein; solute carrier family 19 member 1; CHMD; IFC1; REFC; RFC1; |
Gene ID | 6573 |
mRNA Refseq | NM_001205206 |
Protein Refseq | NP_001192135 |
MIM | 600424 |
UniProt ID | P41440 |
◆ Recombinant Proteins | ||
Slc19a1-2834R | Recombinant Rat Slc19a1 Protein, His-tagged, OVA Conjugated | +Inquiry |
SLC19A1-1295H | Recombinant Human SLC19A1 Protein (V2-Q591), 8×His-Strep, Flag tagged | +Inquiry |
SLC19A1-8246M | Recombinant Mouse SLC19A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC19A1-4242H | Recombinant Human SLC19A1 protein, His&Myc-tagged | +Inquiry |
SLC19A1-1651C | Recombinant Chicken SLC19A1 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SLC19A1 Products
Required fields are marked with *
My Review for All SLC19A1 Products
Required fields are marked with *
0
Inquiry Basket