Recombinant Human SLC19A3 protein, His-tagged
Cat.No. : | SLC19A3-5333H |
Product Overview : | Recombinant Human SLC19A3 protein(Q9BZV2)(208-273aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 208-273a.a. |
Tag : | His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 11.4 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | KKSSSVNPVLEETHEGEAPGCEEQKPTSEILSTSGKLNKGQLNSLKPSNVTVDVFVQWFQDLKECY |
Gene Name | SLC19A3 solute carrier family 19, member 3 [ Homo sapiens ] |
Official Symbol | SLC19A3 |
Synonyms | SLC19A3; solute carrier family 19, member 3; thiamine transporter 2; THTR2; thTr-2; BBGD; THMD2; |
Gene ID | 80704 |
mRNA Refseq | NM_025243 |
Protein Refseq | NP_079519 |
MIM | 606152 |
UniProt ID | Q9BZV2 |
◆ Recombinant Proteins | ||
SLC19A3-4228R | Recombinant Rhesus monkey SLC19A3 Protein, His-tagged | +Inquiry |
SLC19A3-4044R | Recombinant Rhesus Macaque SLC19A3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Slc19a3-5908M | Recombinant Mouse Slc19a3 Protein, Myc/DDK-tagged | +Inquiry |
SLC19A3-0663H | Recombinant Human SLC19A3 Protein (D2-L496), 8×His-MBP, Flag tagged | +Inquiry |
SLC19A3-8247M | Recombinant Mouse SLC19A3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC19A3-599HCL | Recombinant Human SLC19A3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC19A3 Products
Required fields are marked with *
My Review for All SLC19A3 Products
Required fields are marked with *