Recombinant Human SLC1A4 protein, GST-tagged
| Cat.No. : | SLC1A4-3761H |
| Product Overview : | Recombinant Human SLC1A4 protein(431-532 aa), fused to GST tag, was expressed in E. coli. |
| Availability | October 03, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 431-532 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | IAIILEAIGLPTHDLPLILAVDWIVDRTTTVVNVEGDALGAGILHHLNQKATKKGEQELAEVKVEAIPNCKSEEETSPLVTHQNPAGPVASAPELESKESVL |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | SLC1A4 solute carrier family 1 (glutamate/neutral amino acid transporter), member 4 [ Homo sapiens ] |
| Official Symbol | SLC1A4 |
| Synonyms | SLC1A4; solute carrier family 1 (glutamate/neutral amino acid transporter), member 4; neutral amino acid transporter A; alanine/serine/cysteine/threonine transporter; ASCT1; SATT; ASCT-1; solute carrier family 1 member 4; glutamate/neutral amino acid transporter; alanine/serine/cysteine/threonine transporter 1; |
| Gene ID | 6509 |
| mRNA Refseq | NM_001193493 |
| Protein Refseq | NP_001180422 |
| MIM | 600229 |
| UniProt ID | P43007 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC1A4 Products
Required fields are marked with *
My Review for All SLC1A4 Products
Required fields are marked with *
