Recombinant Human SLC1A4 protein, GST-tagged

• Cat.No.: SLC1A4-3761H
• Product Overview: Recombinant Human SLC1A4 protein(431-532 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 431-532 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: IAIILEAIGLPTHDLPLILAVDWIVDRTTTVVNVEGDALGAGILHHLNQKATKKGEQELAEVKVEAIPNCKSEEETSPLVTHQNPAGPVASAPELESKESVL
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: SLC1A4 solute carrier family 1 (glutamate/neutral amino acid transporter), member 4 [ Homo sapiens ]
• Official Symbol: SLC1A4
• Synonyms: SLC1A4; solute carrier family 1 (glutamate/neutral amino acid transporter), member 4; neutral amino acid transporter A; alanine/serine/cysteine/threonine transporter; ASCT1; SATT; ASCT-1; solute carrier family 1 member 4; glutamate/neutral amino acid transporter; alanine/serine/cysteine/threonine transporter 1
• Gene ID: 6509
• mRNA Refseq: NM_001193493
• Protein Refseq: NP_001180422
• MIM: 600229
• UniProt ID: P43007