Recombinant Human SLC20A1 protein, His-tagged
Cat.No. : | SLC20A1-1117H |
Product Overview : | Recombinant Human SLC20A1 protein(263-458 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 263-458 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | KCSPSESPLMEKKNSLKEDHEETKLSVGDIENKHPVSEVGPATVPLQAVVEERTVSFKLGDLEEAPERERLPSVDLKEETSIDSTVNGAVQLPNGNLVQFSQAVSNQINSSGHYQYHTVHKDSGLYKELLHKLHLAKVGDCMGDSGDKPLRRNNSYTSYTMAICGMPLDSFRAKEGEQKGEEMEKLTWPNADSKKR |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | SLC20A1 solute carrier family 20 (phosphate transporter), member 1 [ Homo sapiens ] |
Official Symbol | SLC20A1 |
Synonyms | SLC20A1; solute carrier family 20 (phosphate transporter), member 1; GLVR1; sodium-dependent phosphate transporter 1; gibbon ape leukemia virus receptor 1; Glvr 1; PiT 1; leukemia virus receptor 1 homolog; solute carrier family 20 member 1; PIT1; PiT-1; Glvr-1; FLJ41426; DKFZp686J2397; |
Gene ID | 6574 |
mRNA Refseq | NM_005415 |
Protein Refseq | NP_005406 |
MIM | 137570 |
UniProt ID | Q8WUM9 |
◆ Recombinant Proteins | ||
SLC20A1-5107R | Recombinant Rat SLC20A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC20A1-15259M | Recombinant Mouse SLC20A1 Protein | +Inquiry |
SLC20A1-1117H | Recombinant Human SLC20A1 protein, His-tagged | +Inquiry |
SLC20A1-4048R | Recombinant Rhesus Macaque SLC20A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC20A1-1210H | Recombinant Human SLC20A1 protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC20A1-1797HCL | Recombinant Human SLC20A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC20A1 Products
Required fields are marked with *
My Review for All SLC20A1 Products
Required fields are marked with *