Recombinant Human SLC20A1 protein, His-tagged

• Cat.No.: SLC20A1-1117H
• Product Overview: Recombinant Human SLC20A1 protein(263-458 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 263-458 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
• AASequence: KCSPSESPLMEKKNSLKEDHEETKLSVGDIENKHPVSEVGPATVPLQAVVEERTVSFKLGDLEEAPERERLPSVDLKEETSIDSTVNGAVQLPNGNLVQFSQAVSNQINSSGHYQYHTVHKDSGLYKELLHKLHLAKVGDCMGDSGDKPLRRNNSYTSYTMAICGMPLDSFRAKEGEQKGEEMEKLTWPNADSKKR
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: SLC20A1 solute carrier family 20 (phosphate transporter), member 1 [ Homo sapiens ]
• Official Symbol: SLC20A1
• Synonyms: SLC20A1; solute carrier family 20 (phosphate transporter), member 1; GLVR1; sodium-dependent phosphate transporter 1; gibbon ape leukemia virus receptor 1; Glvr 1; PiT 1; leukemia virus receptor 1 homolog; solute carrier family 20 member 1; PIT1; PiT-1; Glvr-1; FLJ41426; DKFZp686J2397
• Gene ID: 6574
• mRNA Refseq: NM_005415
• Protein Refseq: NP_005406
• MIM: 137570
• UniProt ID: Q8WUM9