Recombinant Human SLC20A2
| Cat.No. : | SLC20A2-31411TH |
| Product Overview : | Recombinant fragment of Human SLC20A2 with N-terminal proprietary tag. Predicted MW 36.63kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 100 amino acids |
| Description : | Sodium-dependent phosphate transporter 2 is a protein that in humans is encoded by the SLC20A2 gene. |
| Molecular Weight : | 36.630kDa inclusive of tags |
| Tissue specificity : | Ubiquitously expressed. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | TGKLQKEGALSRVSDESLSKVQEAESPVFKELPGAKANDDSTIPLTGAAGETLGTSEGTSAGSHPRAAYGRALSMTHGSVKSPISNGTFGFDGHTRSDGH |
| Sequence Similarities : | Belongs to the inorganic phosphate transporter (PiT) (TC 2.A.20) family. |
| Gene Name | SLC20A2 solute carrier family 20 (phosphate transporter), member 2 [ Homo sapiens ] |
| Official Symbol | SLC20A2 |
| Synonyms | SLC20A2; solute carrier family 20 (phosphate transporter), member 2; GLVR2, MLVAR; sodium-dependent phosphate transporter 2; Glvr 2; PiT 2; |
| Gene ID | 6575 |
| mRNA Refseq | NM_006749 |
| Protein Refseq | NP_006740 |
| MIM | 158378 |
| Uniprot ID | Q08357 |
| Chromosome Location | 8p12-p11 |
| Pathway | SLC-mediated transmembrane transport, organism-specific biosystem; Sodium-coupled phosphate cotransporters, organism-specific biosystem; Transmembrane transport of small molecules, organism-specific biosystem; Transport of inorganic cations/anions and amino acids/oligopeptides, organism-specific biosystem; |
| Function | inorganic phosphate transmembrane transporter activity; receptor activity; sodium:phosphate symporter activity; symporter activity; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC20A2 Products
Required fields are marked with *
My Review for All SLC20A2 Products
Required fields are marked with *



