Recombinant Human SLC22A6 Protein, GST-tagged

Cat.No. : SLC22A6-1711H
Product Overview : Recombinant Human SLC22A6 protein (476-550aa) was expressed in E. coli with His tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 476-550 a.a.
Form : Lyophilized from sterile PBS, normally 5 % - 8 % trehalose and mannitol are added as protectants before lyophilization.
AA Sequence : SMTAELYPSMPLFIYGAVPVAASAVTVLLPETLGQPLPDTVQDLESRKGKQTRQQQEHQKYMVPLQASAQEKNGL
Purity : 90%
Storage : Store for up to 12 months at -20 centigrade to -80 centigrade as lyophilized powder.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage
Gene Name SLC22A6 solute carrier family 22 (organic anion transporter), member 6 [ Homo sapiens ]
Official Symbol SLC22A6
Synonyms SLC22A6; solute carrier family 22 (organic anion transporter), member 6; solute carrier family 22 member 6; OAT1; PAHT; ROAT1; hPAHT; hROAT1; PAH transporter; organic anion transporter 1; para-aminohippurate transporter; renal organic anion transporter 1; HOAT1; FLJ55736; MGC45260;
Gene ID 9356
mRNA Refseq NM_004790
Protein Refseq NP_004781
MIM 607582
UniProt ID Q4U2R8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLC22A6 Products

Required fields are marked with *

My Review for All SLC22A6 Products

Required fields are marked with *

0
cart-icon