Recombinant Human SLC22A6 Protein, GST-tagged
| Cat.No. : | SLC22A6-1711H |
| Product Overview : | Recombinant Human SLC22A6 protein (476-550aa) was expressed in E. coli with His tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 476-550 a.a. |
| Form : | Lyophilized from sterile PBS, normally 5 % - 8 % trehalose and mannitol are added as protectants before lyophilization. |
| AA Sequence : | SMTAELYPSMPLFIYGAVPVAASAVTVLLPETLGQPLPDTVQDLESRKGKQTRQQQEHQKYMVPLQASAQEKNGL |
| Purity : | 90% |
| Storage : | Store for up to 12 months at -20 centigrade to -80 centigrade as lyophilized powder. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage |
| Gene Name | SLC22A6 solute carrier family 22 (organic anion transporter), member 6 [ Homo sapiens ] |
| Official Symbol | SLC22A6 |
| Synonyms | SLC22A6; solute carrier family 22 (organic anion transporter), member 6; solute carrier family 22 member 6; OAT1; PAHT; ROAT1; hPAHT; hROAT1; PAH transporter; organic anion transporter 1; para-aminohippurate transporter; renal organic anion transporter 1; HOAT1; FLJ55736; MGC45260; |
| Gene ID | 9356 |
| mRNA Refseq | NM_004790 |
| Protein Refseq | NP_004781 |
| MIM | 607582 |
| UniProt ID | Q4U2R8 |
| ◆ Recombinant Proteins | ||
| SLC22A6-4236R | Recombinant Rhesus monkey SLC22A6 Protein, His-tagged | +Inquiry |
| SLC22A6-5119R | Recombinant Rat SLC22A6 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SLC22A6-924C | Recombinant Cynomolgus SLC22A6 Protein, His-tagged | +Inquiry |
| SLC22A6-667C | Recombinant Cynomolgus Monkey SLC22A6 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SLC22A6-0601H | Recombinant Human SLC22A6 Protein (A2-L563), 8×His-Strep, Flag tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SLC22A6-1792HCL | Recombinant Human SLC22A6 293 Cell Lysate | +Inquiry |
| SLC22A6-1793HCL | Recombinant Human SLC22A6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC22A6 Products
Required fields are marked with *
My Review for All SLC22A6 Products
Required fields are marked with *



