Recombinant Human SLC22A6 Protein, GST-tagged
Cat.No. : | SLC22A6-1711H |
Product Overview : | Recombinant Human SLC22A6 protein (476-550aa) was expressed in E. coli with His tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 476-550 a.a. |
Form : | Lyophilized from sterile PBS, normally 5 % - 8 % trehalose and mannitol are added as protectants before lyophilization. |
AA Sequence : | SMTAELYPSMPLFIYGAVPVAASAVTVLLPETLGQPLPDTVQDLESRKGKQTRQQQEHQKYMVPLQASAQEKNGL |
Purity : | 90% |
Storage : | Store for up to 12 months at -20 centigrade to -80 centigrade as lyophilized powder. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage |
Gene Name | SLC22A6 solute carrier family 22 (organic anion transporter), member 6 [ Homo sapiens ] |
Official Symbol | SLC22A6 |
Synonyms | SLC22A6; solute carrier family 22 (organic anion transporter), member 6; solute carrier family 22 member 6; OAT1; PAHT; ROAT1; hPAHT; hROAT1; PAH transporter; organic anion transporter 1; para-aminohippurate transporter; renal organic anion transporter 1; HOAT1; FLJ55736; MGC45260; |
Gene ID | 9356 |
mRNA Refseq | NM_004790 |
Protein Refseq | NP_004781 |
MIM | 607582 |
UniProt ID | Q4U2R8 |
◆ Recombinant Proteins | ||
SLC22A6-667C | Recombinant Cynomolgus Monkey SLC22A6 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC22A6-5460R | Recombinant Rat SLC22A6 Protein | +Inquiry |
SLC22A6-0601H | Recombinant Human SLC22A6 Protein (A2-L563), 8×His-Strep, Flag tagged | +Inquiry |
SLC22A6-4052R | Recombinant Rhesus Macaque SLC22A6 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC22A6-1711H | Recombinant Human SLC22A6 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC22A6-1792HCL | Recombinant Human SLC22A6 293 Cell Lysate | +Inquiry |
SLC22A6-1793HCL | Recombinant Human SLC22A6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SLC22A6 Products
Required fields are marked with *
My Review for All SLC22A6 Products
Required fields are marked with *
0
Inquiry Basket