Recombinant Human SLC22A6 Protein, GST-tagged

• Cat.No.: SLC22A6-1711H
• Product Overview: Recombinant Human SLC22A6 protein (476-550aa) was expressed in E. coli with His tag.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 476-550 a.a.
• Form: Lyophilized from sterile PBS, normally 5 % - 8 % trehalose and mannitol are added as protectants before lyophilization.
• AA Sequence: SMTAELYPSMPLFIYGAVPVAASAVTVLLPETLGQPLPDTVQDLESRKGKQTRQQQEHQKYMVPLQASAQEKNGL
• Purity: 90%
• Storage: Store for up to 12 months at -20 centigrade to -80 centigrade as lyophilized powder.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage

Gene Information

• Gene Name: SLC22A6 solute carrier family 22 (organic anion transporter), member 6 [ Homo sapiens ]
• Official Symbol: SLC22A6
• Synonyms: SLC22A6; solute carrier family 22 (organic anion transporter), member 6; solute carrier family 22 member 6; OAT1; PAHT; ROAT1; hPAHT; hROAT1; PAH transporter; organic anion transporter 1; para-aminohippurate transporter; renal organic anion transporter 1; HOAT1; FLJ55736; MGC45260
• Gene ID: 9356
• mRNA Refseq: NM_004790
• Protein Refseq: NP_004781
• MIM: 607582
• UniProt ID: Q4U2R8