Recombinant Human SLC25A17 Protein, His-tagged
| Cat.No. : | SLC25A17-21H |
| Product Overview : | Recombinant Human SLC25A17 Protein(34-104 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 34-104 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AASequence : | RLRLQVDEKRKSKTTHMVLLEIIKEEGLLAPYRGWFPVISSLCCSNFVYFYTFNSLKALWVKGQHSTTGKD |
| Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| Gene Name | SLC25A17 solute carrier family 25 (mitochondrial carrier; peroxisomal membrane protein, 34kDa), member 17 [ Homo sapiens ] |
| Official Symbol | SLC25A17 |
| Synonyms | SLC25A17; solute carrier family 25 (mitochondrial carrier; peroxisomal membrane protein, 34kDa), member 17; solute carrier family 25 (mitochondrial carrier; peroxisomal membrane protein, 34kD), member 17; peroxisomal membrane protein PMP34; peroxisomal membrane protein (34kD); PMP34; solute carrier family 25 member 17; 34 kDa peroxisomal membrane protein; |
| Gene ID | 10478 |
| mRNA Refseq | NM_006358 |
| Protein Refseq | NP_006349 |
| MIM | 606795 |
| UniProt ID | O43808 |
| ◆ Recombinant Proteins | ||
| SLC25A17-4244R | Recombinant Rhesus monkey SLC25A17 Protein, His-tagged | +Inquiry |
| SLC25A17-21H | Recombinant Human SLC25A17 Protein, His-tagged | +Inquiry |
| SLC25A17-2067H | Recombinant Human SLC25A17 Protein, GST & His-tagged | +Inquiry |
| SLC25A17-8273M | Recombinant Mouse SLC25A17 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SLC25A17-4060R | Recombinant Rhesus Macaque SLC25A17 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC25A17 Products
Required fields are marked with *
My Review for All SLC25A17 Products
Required fields are marked with *



