Recombinant Human SLC25A17 Protein, His-tagged

• Cat.No.: SLC25A17-21H
• Product Overview: Recombinant Human SLC25A17 Protein(34-104 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 34-104 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AASequence: RLRLQVDEKRKSKTTHMVLLEIIKEEGLLAPYRGWFPVISSLCCSNFVYFYTFNSLKALWVKGQHSTTGKD
• Purity: 80%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.

Gene Information

• Gene Name: SLC25A17 solute carrier family 25 (mitochondrial carrier; peroxisomal membrane protein, 34kDa), member 17 [ Homo sapiens ]
• Official Symbol: SLC25A17
• Synonyms: SLC25A17; solute carrier family 25 (mitochondrial carrier; peroxisomal membrane protein, 34kDa), member 17; solute carrier family 25 (mitochondrial carrier; peroxisomal membrane protein, 34kD), member 17; peroxisomal membrane protein PMP34; peroxisomal membrane protein (34kD); PMP34; solute carrier family 25 member 17; 34 kDa peroxisomal membrane protein
• Gene ID: 10478
• mRNA Refseq: NM_006358
• Protein Refseq: NP_006349
• MIM: 606795
• UniProt ID: O43808