Recombinant Human SLC25A20 protein, GST-tagged
| Cat.No. : | SLC25A20-3498H |
| Product Overview : | Recombinant Human SLC25A20 protein(O43772)(1-301aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-301aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 59.9 kDa |
| AA Sequence : | MADQPKPISPLKNLLAGGFGGVCLVFVGHPLDTVKVRLQTQPPSLPGQPPMYSGTFDCFRKTLFREGITGLYRGMAAPIIGVTPMFAVCFFGFGLGKKLQQKHPEDVLSYPQLFAAGMLSGVFTTGIMTPGERIKCLLQIQASSGESKYTGTLDCAKKLYQEFGIRGIYKGTVLTLMRDVPASGMYFMTYEWLKNIFTPEGKRVSELSAPRILVAGGIAGIFNWAVAIPPDVLKSRFQTAPPGKYPNGFRDVLRELIRDEGVTSLYKGFNAVMIRAFPANAACFLGFEVAMKFLNWATPNL |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | SLC25A20 solute carrier family 25 (carnitine/acylcarnitine translocase), member 20 [ Homo sapiens ] |
| Official Symbol | SLC25A20 |
| Synonyms | SLC25A20; solute carrier family 25 (carnitine/acylcarnitine translocase), member 20; CACT; mitochondrial carnitine/acylcarnitine carrier protein; CAC; carnitine acylcarnitine carrier; carnitine/acylcarnitine translocase; |
| Gene ID | 788 |
| mRNA Refseq | NM_000387 |
| Protein Refseq | NP_000378 |
| MIM | 613698 |
| UniProt ID | O43772 |
| ◆ Recombinant Proteins | ||
| SLC25A20-669C | Recombinant Cynomolgus Monkey SLC25A20 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SLC25A20-926C | Recombinant Cynomolgus SLC25A20 Protein, His-tagged | +Inquiry |
| SLC25A20-3498H | Recombinant Human SLC25A20 protein, GST-tagged | +Inquiry |
| SLC25A20-4071H | Recombinant Human SLC25A20 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SLC25A20-1199H | Recombinant Human SLC25A20 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SLC25A20-1777HCL | Recombinant Human SLC25A20 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC25A20 Products
Required fields are marked with *
My Review for All SLC25A20 Products
Required fields are marked with *
