Recombinant Human SLC25A20 protein, His-tagged
Cat.No. : | SLC25A20-3754H |
Product Overview : | Recombinant Human SLC25A20 protein(96-209 aa), fused to His tag, was expressed in E. coli. |
Availability | August 06, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 96-209 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | GKKLQQKHPEDVLSYPQLFAAGMLSGVFTTGIMTPGERIKCLLQIQASSGESKYTGTLDCAKKLYQEFGIRGIYKGTVLTLMRDVPASGMYFMTYEWLKNIFTPEGKRVSELSA |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | SLC25A20 solute carrier family 25 (carnitine/acylcarnitine translocase), member 20 [ Homo sapiens ] |
Official Symbol | SLC25A20 |
Synonyms | SLC25A20; solute carrier family 25 (carnitine/acylcarnitine translocase), member 20; CACT; mitochondrial carnitine/acylcarnitine carrier protein; CAC; carnitine acylcarnitine carrier; carnitine/acylcarnitine translocase; |
Gene ID | 788 |
mRNA Refseq | NM_000387 |
Protein Refseq | NP_000378 |
MIM | 613698 |
UniProt ID | O43772 |
◆ Recombinant Proteins | ||
SLC25A20-15306M | Recombinant Mouse SLC25A20 Protein | +Inquiry |
Slc25a20-1767R | Recombinant Rat Slc25a20 protein, His & T7-tagged | +Inquiry |
SLC25A20-3754H | Recombinant Human SLC25A20 protein, His-tagged | +Inquiry |
SLC25A20-926C | Recombinant Cynomolgus SLC25A20 Protein, His-tagged | +Inquiry |
SLC25A20-2025H | Recombinant Human SLC25A20 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC25A20-1777HCL | Recombinant Human SLC25A20 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC25A20 Products
Required fields are marked with *
My Review for All SLC25A20 Products
Required fields are marked with *