Recombinant Human SLC25A33 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SLC25A33-2990H
• Product Overview: SLC25A33 MS Standard C13 and N15-labeled recombinant protein (NP_115691) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: SLC25A33 belongs to the SLC25 family of mitochondrial carrier proteins.
• Molecular Mass: 35.4 kDa
• AA Sequence: MATGGQQKENTLLHLFAGGCGGTVGAIFTCPLEVIKTRLQSSRLALRTVYYPQVHLGTISGAGMVRPTSVTPGLFQVLKSILEKEGPKSLFRGLGPNLVGVAPSRAVYFACYSKAKEQFNGIFVPNSNIVHIFSAGSAAFITNSLMNPIWMVKTRMQLEQKVRGSKQMNTLQCARYVYQTEGIRGFYRGLTASYAGISETIICFAIYESLKKYLKEAPLASSANGTEKNSTSFFGLMAAAALSKGCASCIAYPHEVIRTRLREEGTKYKSFVQTARLVFREEGYLAFYRGLFAQLIRQIPNTAIVLSTYELIVYLLEDRTQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SLC25A33 solute carrier family 25 member 33 [ Homo sapiens (human) ]
• Official Symbol: SLC25A33
• Synonyms: SLC25A33; solute carrier family 25 member 33; PNC1; BMSC-MCP; solute carrier family 25 member 33; bone marrow stromal cell mitochondrial carrier protein; huBMSC-MCP; mitochondrial carrier protein; novel mitochondrial carrier protein; solute carrier family 25 (pyrimidine nucleotide carrier), member 33
• Gene ID: 84275
• mRNA Refseq: NM_032315
• Protein Refseq: NP_115691
• MIM: 610816
• UniProt ID: Q9BSK2