Recombinant Human SLC25A36 Protein, GST-tagged

Cat.No. : SLC25A36-4219H
Product Overview : Human FLJ10618 full-length ORF ( AAH14064, 1 a.a. - 311 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : SLC25A36 (Solute Carrier Family 25 Member 36) is a Protein Coding gene. GO annotations related to this gene include pyrimidine nucleotide transmembrane transporter activity. An important paralog of this gene is SLC25A33.
Molecular Mass : 59.95 kDa
AA Sequence : MSQRDTLVHLFAGGCGGTVGAILTCPLEVVKTRLQSSSVTLYISEVQLNTMAGASVNRVVSPGPLHCLKVILEKEGPRSLFRGLGPNLVGVAPSRAIYFAAYSNCKEKLNDVFDPDSTQVHMISAAMAGFTAITATNPIWLIKTRLQLDARNRGERRMGAFECVRKVYQTDGLKGFYRGMSASYAGISETVIHFVIYESIKQKLLEYKTASTMENDEESVKEASDFVGMMLAAATSKTCATTIAYPHEVVRTRLREEGTKYRSFFQTLSLLVQEEGYGSLYRGLTTHLVRQIPNTAIMMATYELVVYLLNG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name SLC25A36 solute carrier family 25 (pyrimidine nucleotide carrier ), member 36 [ Homo sapiens ]
Official Symbol SLC25A36
Synonyms SLC25A36; solute carrier family 25 (pyrimidine nucleotide carrier ), member 36; solute carrier family 25, member 36; solute carrier family 25 member 36; FLJ10618; PNC2; DKFZp564C053;
Gene ID 55186
mRNA Refseq NM_001104647
Protein Refseq NP_001098117
MIM 616149
UniProt ID Q96CQ1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLC25A36 Products

Required fields are marked with *

My Review for All SLC25A36 Products

Required fields are marked with *

0
cart-icon