Recombinant Human SLC25A37 protein, His-tagged
| Cat.No. : | SLC25A37-3533H |
| Product Overview : | Recombinant Human SLC25A37 protein(1-44 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-44 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | MELRSGSVGSQAVARRMDGDSRDGGGGKDATGSEDYENLPTSAS |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | SLC25A37 solute carrier family 25 (mitochondrial iron transporter), member 37 [ Homo sapiens ] |
| Official Symbol | SLC25A37 |
| Synonyms | SLC25A37; solute carrier family 25 (mitochondrial iron transporter), member 37; solute carrier family 25, member 37; mitoferrin-1; MFRN; MFRN1; mitoferrin; MSCP; predicted protein of HQ2217; mitochondrial iron transporter 1; mitochondrial solute carrier protein; MSC; HT015; PRO1278; PRO1584; PRO2217; |
| Gene ID | 51312 |
| mRNA Refseq | NM_016612 |
| Protein Refseq | NP_057696 |
| MIM | 610387 |
| UniProt ID | Q9NYZ2 |
| ◆ Recombinant Proteins | ||
| SLC25A37-1213H | Recombinant Human SLC25A37 protein, His & T7-tagged | +Inquiry |
| SLC25A37-5476R | Recombinant Rat SLC25A37 Protein | +Inquiry |
| SLC25A37-5135R | Recombinant Rat SLC25A37 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SLC25A37-3689Z | Recombinant Zebrafish SLC25A37 | +Inquiry |
| RFL14472DF | Recombinant Full Length Danio Rerio Mitoferrin-1(Slc25A37) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC25A37 Products
Required fields are marked with *
My Review for All SLC25A37 Products
Required fields are marked with *



