Recombinant Human SLC25A37 protein, His-tagged
Cat.No. : | SLC25A37-3533H |
Product Overview : | Recombinant Human SLC25A37 protein(1-44 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-44 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | MELRSGSVGSQAVARRMDGDSRDGGGGKDATGSEDYENLPTSAS |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | SLC25A37 solute carrier family 25 (mitochondrial iron transporter), member 37 [ Homo sapiens ] |
Official Symbol | SLC25A37 |
Synonyms | SLC25A37; solute carrier family 25 (mitochondrial iron transporter), member 37; solute carrier family 25, member 37; mitoferrin-1; MFRN; MFRN1; mitoferrin; MSCP; predicted protein of HQ2217; mitochondrial iron transporter 1; mitochondrial solute carrier protein; MSC; HT015; PRO1278; PRO1584; PRO2217; |
Gene ID | 51312 |
mRNA Refseq | NM_016612 |
Protein Refseq | NP_057696 |
MIM | 610387 |
UniProt ID | Q9NYZ2 |
◆ Recombinant Proteins | ||
SLC25A37-1213H | Recombinant Human SLC25A37 protein, His & T7-tagged | +Inquiry |
SLC25A37-15324M | Recombinant Mouse SLC25A37 Protein | +Inquiry |
SLC25A37-3533H | Recombinant Human SLC25A37 protein, His-tagged | +Inquiry |
RFL13221BF | Recombinant Full Length Bovine Mitoferrin-1(Slc25A37) Protein, His-Tagged | +Inquiry |
RFL35524HF | Recombinant Full Length Human Mitoferrin-1(Slc25A37) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC25A37 Products
Required fields are marked with *
My Review for All SLC25A37 Products
Required fields are marked with *