Recombinant Human SLC25A46 protein, His-tagged
Cat.No. : | SLC25A46-3497H |
Product Overview : | Recombinant Human SLC25A46 protein(1-264 aa), fused to His tag, was expressed in E. coli. |
Availability | August 08, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-264 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MHPRRPDGFDGLGYRGGARDEQGFGGAFPARSFSTGSDLGHWVTTPPDIPGSRNLHWGEKSPPYGVPTTSTPYEGPTEEPFSSGGGGSVQGQSSEQLNRFAGFGIGLASLFTENVLAHPCIVLRRQCQVNYHAQHYHLTPFTVINIMYSFNKTQGPRALWKGMGSTFIVQGVTLGAEGIISEFTPLPREVLHKWSPKQIGEHLLLKSLTYVVAMPFYSASLIETVQSEIIRDNTGILECVKEGIGRVIGMGVPHSKRLLPLLSL |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
◆ Recombinant Proteins | ||
SLC25A46-15334M | Recombinant Mouse SLC25A46 Protein | +Inquiry |
SLC25A46-2681H | Recombinant Human SLC25A46 protein, His-tagged | +Inquiry |
RFL11407MF | Recombinant Full Length Mouse Solute Carrier Family 25 Member 46(Slc25A46) Protein, His-Tagged | +Inquiry |
SLC25A46-8295M | Recombinant Mouse SLC25A46 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL28379HF | Recombinant Full Length Human Solute Carrier Family 25 Member 46(Slc25A46) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC25A46-1758HCL | Recombinant Human SLC25A46 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC25A46 Products
Required fields are marked with *
My Review for All SLC25A46 Products
Required fields are marked with *