Recombinant Human SLC25A6 protein, His-KSI-tagged

• Cat.No.: SLC25A6-2732H
• Product Overview: Recombinant Human SLC25A6 protein(P12236)(232-272aa), fused with N-terminal His tag and KSI tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&KSI
• Protein Length: 232-272aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 20.2 kDa
• AA Sequence: DTVRRRMMMQSGRKGADIMYTGTVDCWRKIFRDEGGKAFFK
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: SLC25A6 solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 6 [ Homo sapiens ]
• Official Symbol: SLC25A6
• Synonyms: SLC25A6; solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 6; ANT3; ADP/ATP translocase 3; ANT3Y; MGC17525; ANT 2; ANT 3; ADP,ATP carrier protein 3; ADP/ATP translocator of liver; ADP,ATP carrier protein, liver; adenine nucleotide translocator 3; solute carrier family 25 member 6; ADP,ATP carrier protein, isoform T2; AAC3
• Gene ID: 293
• mRNA Refseq: NM_001636
• Protein Refseq: NP_001627
• MIM: 300151
• UniProt ID: P12236