Recombinant Human SLC26A11 Protein, His-tagged
| Cat.No. : | SLC26A11-390H |
| Product Overview : | Recombinant Human SLC26A11 Protein(Q86WA9)(471-590 aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 471-590 aa |
| Form : | Phosphate buffered saline. |
| Molecular Mass : | 15 kDa |
| AASequence : | PETKVSEGPVLVLQPASGLSFPAMEALREEILSRALEVSPPRCLVLECTHVCSIDYTVVLGLGELLQDFQKQGVALAFVGLQVPVLRVLLSADLKGFQYFSTLEEAEKHLRQEPGTQPYN |
| Storage : | Store at -20°C to -80°C. |
| Concentration : | 0.1-1.0 mg/ml |
| Gene Name | SLC26A11 solute carrier family 26, member 11 [ Homo sapiens ] |
| Official Symbol | SLC26A11 |
| Synonyms | SLC26A11; solute carrier family 26, member 11; sodium-independent sulfate anion transporter; MGC46523; |
| Gene ID | 284129 |
| mRNA Refseq | NM_001166347 |
| Protein Refseq | NP_001159819 |
| MIM | 610117 |
| UniProt ID | Q86WA9 |
| ◆ Recombinant Proteins | ||
| SLC26A11-2732H | Recombinant Human SLC26A11, GST-tagged | +Inquiry |
| SLC26A11-390H | Recombinant Human SLC26A11 Protein, His-tagged | +Inquiry |
| SLC26A11-10156Z | Recombinant Zebrafish SLC26A11 | +Inquiry |
| SLC26A11-3974H | Recombinant Human SLC26A11 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SLC26A11-1755HCL | Recombinant Human SLC26A11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC26A11 Products
Required fields are marked with *
My Review for All SLC26A11 Products
Required fields are marked with *



