Recombinant Human SLC26A11 Protein, His-tagged

• Cat.No.: SLC26A11-390H
• Product Overview: Recombinant Human SLC26A11 Protein(Q86WA9)(471-590 aa), fused with C-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 471-590 aa
• Form: Phosphate buffered saline.
• Molecular Mass: 15 kDa
• AASequence: PETKVSEGPVLVLQPASGLSFPAMEALREEILSRALEVSPPRCLVLECTHVCSIDYTVVLGLGELLQDFQKQGVALAFVGLQVPVLRVLLSADLKGFQYFSTLEEAEKHLRQEPGTQPYN
• Storage: Store at -20°C to -80°C.
• Concentration: 0.1-1.0 mg/ml

Gene Information

• Gene Name: SLC26A11 solute carrier family 26, member 11 [ Homo sapiens ]
• Official Symbol: SLC26A11
• Synonyms: SLC26A11; solute carrier family 26, member 11; sodium-independent sulfate anion transporter; MGC46523
• Gene ID: 284129
• mRNA Refseq: NM_001166347
• Protein Refseq: NP_001159819
• MIM: 610117
• UniProt ID: Q86WA9