Recombinant Human SLC26A4 protein, GST-tagged
Cat.No. : | SLC26A4-317H |
Product Overview : | Recombinant Human SLC26A4(1 a.a. - 780 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1 a.a. - 780 a.a. |
Description : | Mutations in this gene are associated with Pendred syndrome, the most common form of syndromic deafness, an autosomal-recessive disease. It is highly homologous to the SLC26A3 gene; they have similar genomic structures and this gene is located 3' of the SLC26A3 gene. The encoded protein has homology to sulfate transporters. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 112.75 kDa |
AA Sequence : | MAAPGGRSEPPQLPEYSCSYMVSRPVYSELAFQQQHERRLQERKTLRESLAKCCSCSRKRAFGVLKTLVPILEWL PKYRVKEWLLSDVISGVSTGLVATLQGMAYALLAAVPVGYGLYSAFFPILTYFIFGTSRHISVGPFPVVSLMVGS VVLSMAPDEHFLVSSSNGTVLNTTMIDTAARDTARVLIASALTLLVGIIQLIFGGLQIGFIVRYLADPLVGGFTT AAAFQVLVSQLKIVLNVSTKNYNGVLSIIYTLVEIFQNIGDTNLADFTAGLLTIVVCMAVKELNDRFRHKIPVPI PIEVIVTIIATAISYGANLEKNYNAGIVKSIPRGFLPPELPPVSLFSEMLAASFSIAVVAYAIAVSVGKVYATKY DYTIDGNQEFIAFGISNIFSGFFSCFVATTALSRTAVQESTGGKTQVAGIISAAIVMIAILALGKLLEPLQKSVL AAVVIANLKGMFMQLCDIPRLWRQNKIDAVIWVFTCIVSIILGLDLGLLAGLIFGLLTVVLRVQFPSWNGLGSIP STDIYKSTKNYKNIEEPQGVKILRFSSPIFYGNVDGFKKCIKSTVGFDAIRVYNKRLKALRKIQKLIKSGQLRAT KNGIISDAVSTNNAFEPDEDIEDLEELDIPTKEIEIQVDWNSELPVKVNVPKVPIHSLVLDCGAISFLDVVGVRS LRVIVKEFQRIDVNVYFASLQDYVIEKLEQCGFFDDNIRKDTFFLTVHDAILYLQNQVKSQEGQGSILETITLIQ DCKDTLELIETELTEEELDVQDEAMRTLAS |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | SLC26A4 solute carrier family 26, member 4 [ Homo sapiens ] |
Official Symbol | SLC26A4 |
Synonyms | SLC26A4; solute carrier family 26, member 4; DFNB4; pendrin; PDS; sodium-independent chloride/iodide transporter; EVA; TDH2B; |
Gene ID | 5172 |
mRNA Refseq | NM_000441 |
Protein Refseq | NP_000432 |
MIM | 605646 |
UniProt ID | O43511 |
Chromosome Location | 7q31 |
Pathway | Multifunctional anion exchangers, organism-specific biosystem; SLC-mediated transmembrane transport, organism-specific biosystem; Transmembrane transport of small molecules, organism-specific biosystem; Transport of inorganic cations/anions and amino acids/oligopeptides, organism-specific biosystem; |
Function | chloride transmembrane transporter activity; iodide transmembrane transporter activity; secondary active sulfate transmembrane transporter activity; sulfate transmembrane transporter activity; transporter activity; |
◆ Recombinant Proteins | ||
SLC26A4-7579Z | Recombinant Zebrafish SLC26A4 | +Inquiry |
SLC26A4-5144R | Recombinant Rat SLC26A4 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC26A4-9278H | Recombinant Human SLC26A4 Full Length Transmembrane protein, His-tagged | +Inquiry |
SLC26A4-5485R | Recombinant Rat SLC26A4 Protein | +Inquiry |
SLC26A4-318H | Recombinant Human SLC26A4 protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC26A4 Products
Required fields are marked with *
My Review for All SLC26A4 Products
Required fields are marked with *