Recombinant Human SLC26A5, GST-tagged
Cat.No. : | SLC26A5-112H |
Product Overview : | Recombinant Human SLC26A5(1 a.a. - 447 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the SLC26A/SulP transporter family. The protein functions as a molecular motor in motile outer hair cells (OHCs) of the cochlea, inducing changes in cell length that act to amplify sound levels. The transmembrane protein is an incomplete anion transporter, and does not allow anions to cross the cell membrane but instead undergoes a conformational change in response to changes in intracellular Cl- levels that results in a change in cell length. The protein functions at microsecond rates, which is several orders of magnitude faster than conventional molecular motor proteins. Mutations in this gene are potential candidates for causing neurosensory deafness. Multiple transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 75 kDa |
AA Sequence : | MDHAEENEILAATQRYYVERPIFSHPVLQERLHTKDKVPDSIADKLKQAFTCTPKKIRNIIYMFLPITKWLPAYK FKEYVLGDLVSGISTGVLQLPQGLAFAMLAAVPPIFGLYSSFYPVIMYCFLGTSRHISIGPFAVISLMIGGVAVR LVPDDIVIPGGVNATNGTEARDALRVKVAMSVTLLSGIIQFCLGVCRFGFVAIYLTEPLVRGFTTAAAVHVFTSM LKYLFGVKTKRYSGIFSVVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKEFNERFKEKLPAPIPLEFFAVVMG TGISAGFNLKESYNVDVVGTLPLGLLPPANPDTSLFHLVYVDAIAIAIVGFSVTISMAKTLANKHGYQVDGNQEL IALGLCNSIGSLFQTFSISCSLSRSLVQEGTGGKTQTIWLTTFVSSLFLGLDYGLITAVIIALLTVIYRTQR |
Applications : | ELISA; WB-Re; AP; Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | SLC26A5 solute carrier family 26 (anion exchanger), member 5 [ Homo sapiens (human) ] |
Official Symbol | SLC26A5 |
Synonyms | SLC26A5; solute carrier family 26, member 5 (prestin); PRES, prestin (motor protein); prestin; deafness; neurosensory; autosomal recessive; 61; DFNB61; prestin (motor protein); PRES; MGC118886; MGC118887; MGC118888; MGC118889 |
Gene ID | 375611 |
mRNA Refseq | NM_001167962 |
Protein Refseq | NP_001161434 |
MIM | 604943 |
UniProt ID | P58743 |
Chromosome Location | 7q22.1 |
Function | secondary active sulfate transmembrane transporter activity; spectrin binding |
◆ Recombinant Proteins | ||
SLC26A5-8302M | Recombinant Mouse SLC26A5 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC26A5-11519Z | Recombinant Zebrafish SLC26A5 | +Inquiry |
SLC26A5-1190P | Recombinant Pig SLC26A5 Protein, His-tagged | +Inquiry |
SLC26A5-112H | Recombinant Human SLC26A5, GST-tagged | +Inquiry |
SLC26A5-3517C | Recombinant Chicken SLC26A5 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SLC26A5 Products
Required fields are marked with *
My Review for All SLC26A5 Products
Required fields are marked with *
0
Inquiry Basket