Recombinant Human SLC26A5, GST-tagged

Cat.No. : SLC26A5-112H
Product Overview : Recombinant Human SLC26A5(1 a.a. - 447 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the SLC26A/SulP transporter family. The protein functions as a molecular motor in motile outer hair cells (OHCs) of the cochlea, inducing changes in cell length that act to amplify sound levels. The transmembrane protein is an incomplete anion transporter, and does not allow anions to cross the cell membrane but instead undergoes a conformational change in response to changes in intracellular Cl- levels that results in a change in cell length. The protein functions at microsecond rates, which is several orders of magnitude faster than conventional molecular motor proteins. Mutations in this gene are potential candidates for causing neurosensory deafness. Multiple transcript variants encoding different isoforms have been found for this gene.
Molecular Mass : 75 kDa
AA Sequence : MDHAEENEILAATQRYYVERPIFSHPVLQERLHTKDKVPDSIADKLKQAFTCTPKKIRNIIYMFLPITKWLPAYK FKEYVLGDLVSGISTGVLQLPQGLAFAMLAAVPPIFGLYSSFYPVIMYCFLGTSRHISIGPFAVISLMIGGVAVR LVPDDIVIPGGVNATNGTEARDALRVKVAMSVTLLSGIIQFCLGVCRFGFVAIYLTEPLVRGFTTAAAVHVFTSM LKYLFGVKTKRYSGIFSVVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKEFNERFKEKLPAPIPLEFFAVVMG TGISAGFNLKESYNVDVVGTLPLGLLPPANPDTSLFHLVYVDAIAIAIVGFSVTISMAKTLANKHGYQVDGNQEL IALGLCNSIGSLFQTFSISCSLSRSLVQEGTGGKTQTIWLTTFVSSLFLGLDYGLITAVIIALLTVIYRTQR
Applications : ELISA; WB-Re; AP; Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name SLC26A5 solute carrier family 26 (anion exchanger), member 5 [ Homo sapiens (human) ]
Official Symbol SLC26A5
Synonyms SLC26A5; solute carrier family 26, member 5 (prestin); PRES, prestin (motor protein); prestin; deafness; neurosensory; autosomal recessive; 61; DFNB61; prestin (motor protein); PRES; MGC118886; MGC118887; MGC118888; MGC118889
Gene ID 375611
mRNA Refseq NM_001167962
Protein Refseq NP_001161434
MIM 604943
UniProt ID P58743
Chromosome Location 7q22.1
Function secondary active sulfate transmembrane transporter activity; spectrin binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLC26A5 Products

Required fields are marked with *

My Review for All SLC26A5 Products

Required fields are marked with *

0
cart-icon
0
compare icon