Recombinant Human SLC2A14 protein, GST-tagged
Cat.No. : | SLC2A14-4644H |
Product Overview : | Recombinant Human SLC2A14 protein(450-497 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | GST |
Protein Length : | 450-497 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | KVPETRGRTFEDITRAFEGQAHGADRSGKDGVMGMNSIEPAKETTTNV |
Purity : | 90%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | SLC2A14 solute carrier family 2 (facilitated glucose transporter), member 14 [ Homo sapiens ] |
Official Symbol | SLC2A14 |
Synonyms | SLC2A14; solute carrier family 2 (facilitated glucose transporter), member 14; SLC2A3P3, solute carrier family 2 (facilitated glucose transporter), member 3 pseudogene 3; solute carrier family 2, facilitated glucose transporter member 14; GLUT14; GLUT-14; glucose transporter 14; glucose transporter type 14; solute carrier family 2 (facilitated glucose transporter), member 3 pseudogene 3; SLC2A3P3; DKFZp564K1672; |
mRNA Refseq | NM_153449 |
Protein Refseq | NP_703150 |
MIM | 611039 |
UniProt ID | Q8TDB8 |
Gene ID | 144195 |
◆ Recombinant Proteins | ||
SLC2A14-5673H | Recombinant Human SLC2A14 Protein (Asn51-Val105), N-GST tagged | +Inquiry |
SLC2A14-4644H | Recombinant Human SLC2A14 protein, GST-tagged | +Inquiry |
SLC2A14-1201H | Recombinant Human SLC2A14 protein, His & T7-tagged | +Inquiry |
SLC2A14-1198H | Recombinant Human SLC2A14 protein, His & S-tagged | +Inquiry |
SLC2A14-1199H | Recombinant Human SLC2A14 protein, His & GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC2A14 Products
Required fields are marked with *
My Review for All SLC2A14 Products
Required fields are marked with *
0
Inquiry Basket