Recombinant Human SLC2A14 protein, GST-tagged

• Cat.No.: SLC2A14-4644H
• Product Overview: Recombinant Human SLC2A14 protein(450-497 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E. coli
• Tag: GST
• Protein Length: 450-497 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
• AASequence: KVPETRGRTFEDITRAFEGQAHGADRSGKDGVMGMNSIEPAKETTTNV
• Purity: 90%, by SDS-PAGE.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: SLC2A14 solute carrier family 2 (facilitated glucose transporter), member 14 [ Homo sapiens ]
• Official Symbol: SLC2A14
• Synonyms: SLC2A14; solute carrier family 2 (facilitated glucose transporter), member 14; SLC2A3P3, solute carrier family 2 (facilitated glucose transporter), member 3 pseudogene 3; solute carrier family 2, facilitated glucose transporter member 14; GLUT14; GLUT-14; glucose transporter 14; glucose transporter type 14; solute carrier family 2 (facilitated glucose transporter), member 3 pseudogene 3; SLC2A3P3; DKFZp564K1672
• mRNA Refseq: NM_153449
• Protein Refseq: NP_703150
• MIM: 611039
• UniProt ID: Q8TDB8
• Gene ID: 144195