Recombinant Human SLC2A9 protein, His-tagged
| Cat.No. : | SLC2A9-2547H |
| Product Overview : | Recombinant Human SLC2A9 protein(443-511 aa), fused to His tag, was expressed in E. coli. |
| Availability | June 18, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 443-511 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | IQKSLDTYCFLVFATICITGAIYLYFVLPETKNRTYAEISQAFSKRNKAYPPEEKIDSAVTDGKINGRP |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | SLC2A9 solute carrier family 2 (facilitated glucose transporter), member 9 [ Homo sapiens ] |
| Official Symbol | SLC2A9 |
| Synonyms | SLC2A9; solute carrier family 2 (facilitated glucose transporter), member 9; solute carrier family 2, facilitated glucose transporter member 9; Glut9; GLUTX; urate voltage driven efflux transporter 1; URATv1; GLUT-9; glucose transporter type 9; human glucose transporter-like protein-9; urate voltage-driven efflux transporter 1; GLUT9; UAQTL2; |
| Gene ID | 56606 |
| mRNA Refseq | NM_001001290 |
| Protein Refseq | NP_001001290 |
| MIM | 606142 |
| UniProt ID | Q9NRM0 |
| ◆ Recombinant Proteins | ||
| SLC2A9-1921H | Recombinant Human SLC2A9 Full Length Transmembrane protein, His-tagged | +Inquiry |
| SLC2A9-2547H | Recombinant Human SLC2A9 protein, His-tagged | +Inquiry |
| SLC2A9-1343S | Recombinant Human SLC2A9 Protein (A2-P540), 8×His-MBP, Flag tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC2A9 Products
Required fields are marked with *
My Review for All SLC2A9 Products
Required fields are marked with *
