Recombinant Human SLC30A7 protein, GST-tagged

Cat.No. : SLC30A7-301453H
Product Overview : Recombinant Human SLC30A7 (287-376 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Arg287-Met376
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : RESVGILMQRTPPLLENSLPQCYQRVQQLQGVYSLQEQHFWTLCSDVYVGTLKLIVAPDADARWILSQTHNIFTQAGVRQLYVQIDFAAM
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name SLC30A7 solute carrier family 30 (zinc transporter), member 7 [ Homo sapiens ]
Official Symbol SLC30A7
Synonyms SLC30A7; solute carrier family 30 (zinc transporter), member 7; zinc transporter 7; ZNT7; ZnTL2; zinc transporter ZnT-7; znt-like transporter 2; zinc transporter like 2; solute carrier family 30 member 7; ZnT-7; DKFZp686M0368;
Gene ID 148867
mRNA Refseq NM_001144884
Protein Refseq NP_001138356
MIM 611149
UniProt ID Q8NEW0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLC30A7 Products

Required fields are marked with *

My Review for All SLC30A7 Products

Required fields are marked with *

0
cart-icon