Recombinant Human SLC30A7 protein, GST-tagged
Cat.No. : | SLC30A7-301453H |
Product Overview : | Recombinant Human SLC30A7 (287-376 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Arg287-Met376 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | RESVGILMQRTPPLLENSLPQCYQRVQQLQGVYSLQEQHFWTLCSDVYVGTLKLIVAPDADARWILSQTHNIFTQAGVRQLYVQIDFAAM |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | SLC30A7 solute carrier family 30 (zinc transporter), member 7 [ Homo sapiens ] |
Official Symbol | SLC30A7 |
Synonyms | SLC30A7; solute carrier family 30 (zinc transporter), member 7; zinc transporter 7; ZNT7; ZnTL2; zinc transporter ZnT-7; znt-like transporter 2; zinc transporter like 2; solute carrier family 30 member 7; ZnT-7; DKFZp686M0368; |
Gene ID | 148867 |
mRNA Refseq | NM_001144884 |
Protein Refseq | NP_001138356 |
MIM | 611149 |
UniProt ID | Q8NEW0 |
◆ Recombinant Proteins | ||
RFL17447MF | Recombinant Full Length Mouse Zinc Transporter 7(Slc30A7) Protein, His-Tagged | +Inquiry |
SLC30A7-5862Z | Recombinant Zebrafish SLC30A7 | +Inquiry |
RFL31645XF | Recombinant Full Length Xenopus Tropicalis Zinc Transporter 7(Slc30A7) Protein, His-Tagged | +Inquiry |
SLC30A7-3991H | Recombinant Human SLC30A7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SLC30A7-301453H | Recombinant Human SLC30A7 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC30A7 Products
Required fields are marked with *
My Review for All SLC30A7 Products
Required fields are marked with *