Recombinant Human SLC31A1 protein, His-tagged
Cat.No. : | SLC31A1-6744H |
Product Overview : | Recombinant Human SLC31A1 protein(1-70 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | His |
Protein Length : | 1-70 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | MDHSHHMGMSYMDSNSTMQPSHHHPTTSASHSHGGGDSSMMMMPMTFYFGFKNVELLFSGLVINTAGEMA |
Purity : | 90%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | SLC31A1 solute carrier family 31 (copper transporters), member 1 [ Homo sapiens ] |
Official Symbol | SLC31A1 |
Synonyms | SLC31A1; solute carrier family 31 (copper transporters), member 1; COPT1; high affinity copper uptake protein 1; copper transport 1 homolog (S. cerevisiae); CTR1; hCTR1; copper transporter 1; copper transport 1 homolog; solute carrier family 31 member 1; MGC75487; |
mRNA Refseq | NM_001859 |
Protein Refseq | NP_001850 |
MIM | 603085 |
UniProt ID | O15431 |
Gene ID | 1317 |
◆ Cell & Tissue Lysates | ||
SLC31A1-1736HCL | Recombinant Human SLC31A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC31A1 Products
Required fields are marked with *
My Review for All SLC31A1 Products
Required fields are marked with *