Recombinant Human SLC33A1 protein, GST-tagged
| Cat.No. : | SLC33A1-301153H |
| Product Overview : | Recombinant Human SLC33A1 (1-73 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Met1-Ser73 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | MSPTISHKDSSRQRRPGNFSHSLDMKSGPLPPGGWDDSHLDSAGREGDREALLGDTGTGDFLKAPQSFRAELS |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | SLC33A1 solute carrier family 33 (acetyl-CoA transporter), member 1 [ Homo sapiens ] |
| Official Symbol | SLC33A1 |
| Synonyms | SLC33A1; solute carrier family 33 (acetyl-CoA transporter), member 1; ACATN, acetyl Coenzyme A transporter , spastic paraplegia 42 (autosomal dominant) , SPG42; acetyl-coenzyme A transporter 1; AT 1; AT1; AT-1; ACATN; SPG42; CCHLND; |
| Gene ID | 9197 |
| mRNA Refseq | NM_001190992 |
| Protein Refseq | NP_001177921 |
| MIM | 603690 |
| UniProt ID | O00400 |
| ◆ Recombinant Proteins | ||
| SLC33A1-0854H | Recombinant Human SLC33A1 Protein (S2-N549), 8×His-MBP, Flag tagged | +Inquiry |
| SLC33A1-5168R | Recombinant Rat SLC33A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SLC33A1-703HF | Recombinant Full Length Human SLC33A1 Protein, GST-tagged | +Inquiry |
| SLC33A1-5509R | Recombinant Rat SLC33A1 Protein | +Inquiry |
| SLC33A1-3052H | Recombinant Human SLC33A1, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SLC33A1-1629HCL | Recombinant Human SLC33A1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC33A1 Products
Required fields are marked with *
My Review for All SLC33A1 Products
Required fields are marked with *
