Recombinant Human SLC33A1 protein, GST-tagged

Cat.No. : SLC33A1-301153H
Product Overview : Recombinant Human SLC33A1 (1-73 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Met1-Ser73
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : MSPTISHKDSSRQRRPGNFSHSLDMKSGPLPPGGWDDSHLDSAGREGDREALLGDTGTGDFLKAPQSFRAELS
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name SLC33A1 solute carrier family 33 (acetyl-CoA transporter), member 1 [ Homo sapiens ]
Official Symbol SLC33A1
Synonyms SLC33A1; solute carrier family 33 (acetyl-CoA transporter), member 1; ACATN, acetyl Coenzyme A transporter , spastic paraplegia 42 (autosomal dominant) , SPG42; acetyl-coenzyme A transporter 1; AT 1; AT1; AT-1; ACATN; SPG42; CCHLND;
Gene ID 9197
mRNA Refseq NM_001190992
Protein Refseq NP_001177921
MIM 603690
UniProt ID O00400

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLC33A1 Products

Required fields are marked with *

My Review for All SLC33A1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon