Recombinant Human SLC33A1 protein, GST-tagged

• Cat.No.: SLC33A1-301153H
• Product Overview: Recombinant Human SLC33A1 (1-73 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Met1-Ser73
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: MSPTISHKDSSRQRRPGNFSHSLDMKSGPLPPGGWDDSHLDSAGREGDREALLGDTGTGDFLKAPQSFRAELS
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: SLC33A1 solute carrier family 33 (acetyl-CoA transporter), member 1 [ Homo sapiens ]
• Official Symbol: SLC33A1
• Synonyms: SLC33A1; solute carrier family 33 (acetyl-CoA transporter), member 1; ACATN, acetyl Coenzyme A transporter , spastic paraplegia 42 (autosomal dominant) , SPG42; acetyl-coenzyme A transporter 1; AT 1; AT1; AT-1; ACATN; SPG42; CCHLND
• Gene ID: 9197
• mRNA Refseq: NM_001190992
• Protein Refseq: NP_001177921
• MIM: 603690
• UniProt ID: O00400