Recombinant Human SLC34A2 Protein (574-689 aa), His-B2M-tagged
Cat.No. : | SLC34A2-2318H |
Product Overview : | Recombinant Human SLC34A2 Protein (574-689 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-B2M tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | B2M&His |
Protein Length : | 574-689 aa |
Description : | May be involved in actively transporting phosphate into cells via Na+ cotransport. It may be the main phosphate transport protein in the intestinal brush border membrane. May have a role in the synthesis of surfactant in lungs' alveoli. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 27.1 kDa |
AA Sequence : | LLQSRCPRVLPKKLQNWNFLPLWMRSLKPWDAVVSKFTGCFQMRCCCCCRVCCRACCLLCDCPKCCRCSKCCEDLEEAQEGQDVPVKAPETFDNITISREAQGEVPASDSKTECTA |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | SLC34A2 solute carrier family 34 member 2 [ Homo sapiens (human) ] |
Official Symbol | SLC34A2 |
Synonyms | SLC34A2; NPTIIb; NAPI-3B; NAPI-Iib; |
Gene ID | 10568 |
mRNA Refseq | NM_001177999 |
Protein Refseq | NP_001171470 |
UniProt ID | O95436 |
◆ Recombinant Proteins | ||
SLC34A2-3216H | Recombinant Human SLC34A2 protein(Val234~Leu362), His-SUMO-tagged | +Inquiry |
SLC34A2-5411H | Recombinant Human SLC34A2 Protein (Met1-Leu104), N-His tagged | +Inquiry |
SLC34A2-2031H | Recombinant Human SLC34A2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC34A2-5170R | Recombinant Rat SLC34A2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC34A2-132HFL | Recombinant Full Length Human SLC34A2 Protein, C-Flag-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC34A2 Products
Required fields are marked with *
My Review for All SLC34A2 Products
Required fields are marked with *