Recombinant Human SLC34A2 Protein (574-689 aa), His-B2M-tagged

• Cat.No.: SLC34A2-2318H
• Product Overview: Recombinant Human SLC34A2 Protein (574-689 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-B2M tag at the N-terminal. Protein Description: Partial.

Specification

• Species: Human
• Source: E.coli
• Tag: B2M&His
• Protein Length: 574-689 aa
• Description: May be involved in actively transporting phosphate into cells via Na+ cotransport. It may be the main phosphate transport protein in the intestinal brush border membrane. May have a role in the synthesis of surfactant in lungs' alveoli.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 27.1 kDa
• AA Sequence: LLQSRCPRVLPKKLQNWNFLPLWMRSLKPWDAVVSKFTGCFQMRCCCCCRVCCRACCLLCDCPKCCRCSKCCEDLEEAQEGQDVPVKAPETFDNITISREAQGEVPASDSKTECTA
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: SLC34A2 solute carrier family 34 member 2 [ Homo sapiens (human) ]
• Official Symbol: SLC34A2
• Synonyms: SLC34A2; NPTIIb; NAPI-3B; NAPI-Iib
• Gene ID: 10568
• mRNA Refseq: NM_001177999
• Protein Refseq: NP_001171470
• UniProt ID: O95436