Recombinant Human SLC35A1 Protein, GST-tagged

Cat.No. : SLC35A1-665H
Product Overview : Recombinant Human SLC35A1 Full-Length ORF Protein (1-337 aa) is produced by Wheat Germ (in vitro) expression system. This protein is fused with a GST tag at the N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-337 aa
Description : The SLC35A1 gene encodes a CMP-sialic acid transporter located within the membrane of the Golgi apparatus. The transporter moves nucleotide sugars across the membrane for use in glycosylation reactions that take place within the Golgi department (Eckhardt et al., 1996 [PubMed 8755516]). For background information on the SLC35 family of nucleotide-sugar transporters, see SLC35A3 (MIM 605632).
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 63.2 kDa
AA Sequence : MAAPRDNVTLLFKLYCLAVMTLMAAVYTIALRYTRTSDKELYFSTTAVCITEVIKLLLSVGILAKETGSLGRFKASLRENVLGSPKELLKLSVPSLVYAVQNNMAFLALSNLDAAVYQVTYQLKIPCTALCTVLMLNRTLSKLQWVSVFMLCAGVTLVQWKPAQATKVVVEQNPLLGFGAIAIAVLCSGFAGVYFEKVLKSSDTSLWVRNIQMYLSGIIVTLAGVYLSDGAEIKEKGFFYGYTYYVWFVIFLASVGGLYTSVVVKYTDNIMKGFSAAAAIVLSTIASVMLFGLQITLTFALGTLLVCVSIYLYGLPRQDTTSIQQGETASKERVIGV
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name SLC35A1 solute carrier family 35 member A1 [ Homo sapiens (human) ]
Official Symbol SLC35A1
Synonyms CMPST; CST; hCST; inactive;
Gene ID 10559
mRNA Refseq NM_006416
Protein Refseq NP_006407
UniProt ID P78382

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLC35A1 Products

Required fields are marked with *

My Review for All SLC35A1 Products

Required fields are marked with *

0
cart-icon
0
compare icon