Recombinant Human SLC35A1 Protein, GST-tagged
Cat.No. : | SLC35A1-665H |
Product Overview : | Recombinant Human SLC35A1 Full-Length ORF Protein (1-337 aa) is produced by Wheat Germ (in vitro) expression system. This protein is fused with a GST tag at the N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-337 aa |
Description : | The SLC35A1 gene encodes a CMP-sialic acid transporter located within the membrane of the Golgi apparatus. The transporter moves nucleotide sugars across the membrane for use in glycosylation reactions that take place within the Golgi department (Eckhardt et al., 1996 [PubMed 8755516]). For background information on the SLC35 family of nucleotide-sugar transporters, see SLC35A3 (MIM 605632). |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 63.2 kDa |
AA Sequence : | MAAPRDNVTLLFKLYCLAVMTLMAAVYTIALRYTRTSDKELYFSTTAVCITEVIKLLLSVGILAKETGSLGRFKASLRENVLGSPKELLKLSVPSLVYAVQNNMAFLALSNLDAAVYQVTYQLKIPCTALCTVLMLNRTLSKLQWVSVFMLCAGVTLVQWKPAQATKVVVEQNPLLGFGAIAIAVLCSGFAGVYFEKVLKSSDTSLWVRNIQMYLSGIIVTLAGVYLSDGAEIKEKGFFYGYTYYVWFVIFLASVGGLYTSVVVKYTDNIMKGFSAAAAIVLSTIASVMLFGLQITLTFALGTLLVCVSIYLYGLPRQDTTSIQQGETASKERVIGV |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | SLC35A1 solute carrier family 35 member A1 [ Homo sapiens (human) ] |
Official Symbol | SLC35A1 |
Synonyms | CMPST; CST; hCST; inactive; |
Gene ID | 10559 |
mRNA Refseq | NM_006416 |
Protein Refseq | NP_006407 |
UniProt ID | P78382 |
◆ Recombinant Proteins | ||
SLC35A1-6082C | Recombinant Chicken SLC35A1 | +Inquiry |
SLC35A1-1297H | Recombinant Human SLC35A1 Protein (A2-V337), 8×His-MBP, Flag tagged | +Inquiry |
SLC35A1-2752H | Recombinant Human SLC35A1, GST-tagged | +Inquiry |
SLC35A1-4270R | Recombinant Rhesus monkey SLC35A1 Protein, His-tagged | +Inquiry |
SLC35A1-4086R | Recombinant Rhesus Macaque SLC35A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC35A1-1735HCL | Recombinant Human SLC35A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SLC35A1 Products
Required fields are marked with *
My Review for All SLC35A1 Products
Required fields are marked with *
0
Inquiry Basket