| Species : |
Human |
| Source : |
Wheat Germ |
| Tag : |
GST |
| Protein Length : |
1-337 aa |
| Description : |
The SLC35A1 gene encodes a CMP-sialic acid transporter located within the membrane of the Golgi apparatus. The transporter moves nucleotide sugars across the membrane for use in glycosylation reactions that take place within the Golgi department (Eckhardt et al., 1996 [PubMed 8755516]). For background information on the SLC35 family of nucleotide-sugar transporters, see SLC35A3 (MIM 605632). |
| Form : |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : |
63.2 kDa |
| AA Sequence : |
MAAPRDNVTLLFKLYCLAVMTLMAAVYTIALRYTRTSDKELYFSTTAVCITEVIKLLLSVGILAKETGSLGRFKASLRENVLGSPKELLKLSVPSLVYAVQNNMAFLALSNLDAAVYQVTYQLKIPCTALCTVLMLNRTLSKLQWVSVFMLCAGVTLVQWKPAQATKVVVEQNPLLGFGAIAIAVLCSGFAGVYFEKVLKSSDTSLWVRNIQMYLSGIIVTLAGVYLSDGAEIKEKGFFYGYTYYVWFVIFLASVGGLYTSVVVKYTDNIMKGFSAAAAIVLSTIASVMLFGLQITLTFALGTLLVCVSIYLYGLPRQDTTSIQQGETASKERVIGV |
| Applications : |
Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : |
Best use within three months from the date of receipt of this protein |
| Storage : |
Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |