Recombinant Human SLC35A3 protein, His-tagged

Cat.No. : SLC35A3-3649H
Product Overview : Recombinant Human SLC35A3 protein(158-220 aa), fused to His tag, was expressed in E. coli.
Availability October 11, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 158-220 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : SDSQLDSKELSAGSQFVGLMAVLTACFSSGFAGVYFEKILKETKQSVWIRNIQLVSFSLEPSL
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name SLC35A3 solute carrier family 35 (UDP-N-acetylglucosamine (UDP-GlcNAc) transporter), member A3 [ Homo sapiens ]
Official Symbol SLC35A3
Synonyms SLC35A3; solute carrier family 35 (UDP-N-acetylglucosamine (UDP-GlcNAc) transporter), member A3; solute carrier family 35 (UDP N acetylglucosamine (UDP GlcNAc) transporter), member 3; UDP-N-acetylglucosamine transporter; golgi UDP-GlcNAc transporter; solute carrier family 35 member A3; solute carrier family 35 (UDP-N-acetylglucosamine (UDP-GlcNAc) transporter), member 3; DKFZp781P1297;
Gene ID 23443
mRNA Refseq NM_012243
Protein Refseq NP_036375
MIM 605632
UniProt ID Q9Y2D2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLC35A3 Products

Required fields are marked with *

My Review for All SLC35A3 Products

Required fields are marked with *

0
cart-icon
0
compare icon