Recombinant Human SLC35B1 protein, His-tagged
| Cat.No. : | SLC35B1-8785H |
| Product Overview : | Recombinant Human SLC35B1 protein(1-84 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | His |
| Protein Length : | 1-84 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | MASSSSLVPDRLRLPLCFLGVFVCYFYYGILQEKITRGKYGEGAKQETFTFALTLVFIQCVINAVFAKILIQFFDTARVDHTRS |
| Purity : | 85%, by SDS-PAGE. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | SLC35B1 solute carrier family 35, member B1 [ Homo sapiens ] |
| Official Symbol | SLC35B1 |
| Synonyms | SLC35B1; solute carrier family 35, member B1; solute carrier family 35 member B1; UGTREL1; hUGTrel1; UDP-galactose transporter related; UDP-galactose transporter-related protein 1; |
| mRNA Refseq | NM_005827 |
| Protein Refseq | NP_005818 |
| MIM | 610790 |
| UniProt ID | P78383 |
| Gene ID | 10237 |
| ◆ Recombinant Proteins | ||
| SLC35B1-8785H | Recombinant Human SLC35B1 protein, His-tagged | +Inquiry |
| SLC35B1-8334M | Recombinant Mouse SLC35B1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SLC35B1-1305Z | Recombinant Zebrafish SLC35B1 | +Inquiry |
| SLC35B1-5515R | Recombinant Rat SLC35B1 Protein | +Inquiry |
| SLC35B1-5174R | Recombinant Rat SLC35B1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC35B1 Products
Required fields are marked with *
My Review for All SLC35B1 Products
Required fields are marked with *
