Recombinant Human SLC35D1 protein, His-tagged
| Cat.No. : | SLC35D1-6753H |
| Product Overview : | Recombinant Human SLC35D1 protein(89-157 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 89-157 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | VGKALRVVKFPDLDRNVPRKTFPLPLLYFGNQITGLFSTKKLNLPMFTVLRRFSILFTMFAEGVLLKKT |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | SLC35D1 solute carrier family 35 (UDP-glucuronic acid/UDP-N-acetylgalactosamine dual transporter), member D1 [ Homo sapiens ] |
| Official Symbol | SLC35D1 |
| Synonyms | SLC35D1; solute carrier family 35 (UDP-glucuronic acid/UDP-N-acetylgalactosamine dual transporter), member D1; UDP-glucuronic acid/UDP-N-acetylgalactosamine transporter; KIAA0260; UGTREL7; UDP-GlcA/UDP-GalNAc transporter; solute carrier family 35 member D1; UDP-galactose transporter-related 7; UDP-galactose transporter-related protein 7; MGC138236; |
| Gene ID | 23169 |
| mRNA Refseq | NM_015139 |
| Protein Refseq | NP_055954 |
| MIM | 610804 |
| UniProt ID | Q9NTN3 |
| ◆ Recombinant Proteins | ||
| SLC35D1-4092R | Recombinant Rhesus Macaque SLC35D1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SLC35D1-6753H | Recombinant Human SLC35D1 protein, His-tagged | +Inquiry |
| SLC35D1-4276R | Recombinant Rhesus monkey SLC35D1 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC35D1 Products
Required fields are marked with *
My Review for All SLC35D1 Products
Required fields are marked with *
