Recombinant Human SLC39A11 protein, His-GST-tagged
| Cat.No. : | SLC39A11-2708H |
| Product Overview : | Recombinant Human SLC39A11 protein(Q8N1S5)(93-193aa), fused with N-terminal His and GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST&His |
| Protein Length : | 93-193aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 42.2 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | YLADLLMPHLGAAEDPQTTLALNFGSTLMKKKSDPEGPALLFPESELSIRIGRAGLLSDKSENGEAYQRKKAAATGLPEGPAVPVPSRGNLAQPGGSSWRR |
| Gene Name | SLC39A11 solute carrier family 39 (metal ion transporter), member 11 [ Homo sapiens ] |
| Official Symbol | SLC39A11 |
| Synonyms | SLC39A11; solute carrier family 39 (metal ion transporter), member 11; C17orf26, chromosome 17 open reading frame 26; zinc transporter ZIP11; ZIP-11; Zrt- and Irt-like protein 11; solute carrier family 39 member 11; ZIP11; C17orf26; |
| Gene ID | 201266 |
| mRNA Refseq | NM_001159770 |
| Protein Refseq | NP_001153242 |
| UniProt ID | Q8N1S5 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC39A11 Products
Required fields are marked with *
My Review for All SLC39A11 Products
Required fields are marked with *
