Recombinant Human SLC39A11 protein, His-GST-tagged

Cat.No. : SLC39A11-2708H
Product Overview : Recombinant Human SLC39A11 protein(Q8N1S5)(93-193aa), fused with N-terminal His and GST tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST&His
Protein Length : 93-193aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 42.2 kDa
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : YLADLLMPHLGAAEDPQTTLALNFGSTLMKKKSDPEGPALLFPESELSIRIGRAGLLSDKSENGEAYQRKKAAATGLPEGPAVPVPSRGNLAQPGGSSWRR
Gene Name SLC39A11 solute carrier family 39 (metal ion transporter), member 11 [ Homo sapiens ]
Official Symbol SLC39A11
Synonyms SLC39A11; solute carrier family 39 (metal ion transporter), member 11; C17orf26, chromosome 17 open reading frame 26; zinc transporter ZIP11; ZIP-11; Zrt- and Irt-like protein 11; solute carrier family 39 member 11; ZIP11; C17orf26;
Gene ID 201266
mRNA Refseq NM_001159770
Protein Refseq NP_001153242
UniProt ID Q8N1S5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLC39A11 Products

Required fields are marked with *

My Review for All SLC39A11 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon