Recombinant Human SLC39A14 protein, His-tagged
Cat.No. : | SLC39A14-4564H |
Product Overview : | Recombinant Human SLC39A14 protein(Q15043)(31-157aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 31-157a.a. |
Tag : | His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 20.8 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | SSLGAPAISAASFLQDLIHRYGEGDSLTLQQLKALLNHLDVGVGRGNVTQHVQGHRNLSTCFSSGDLFTAHNFSEQSRIGSSELQEFCPTILQQLDSRACTSENQENEENEQTEEGRPSAVEVWGYG |
Gene Name | SLC39A14 solute carrier family 39 (zinc transporter), member 14 [ Homo sapiens ] |
Official Symbol | SLC39A14 |
Synonyms | SLC39A14; solute carrier family 39 (zinc transporter), member 14; solute carrier family 39 (metal ion transporter), member 14; zinc transporter ZIP14; KIAA0062; NET34; ZIP14; ZIP-14; Zrt-, Irt-like protein 14; zrt- and Irt-like protein 14; solute carrier family 39 member 14; LIV-1 subfamily of ZIP zinc transporter 4; cig19; LZT-Hs4; |
Gene ID | 23516 |
mRNA Refseq | NM_001128431 |
Protein Refseq | NP_001121903 |
MIM | 608736 |
UniProt ID | Q15043 |
◆ Recombinant Proteins | ||
SLC39A14-3655H | Recombinant Human SLC39A14 protein, GST-tagged | +Inquiry |
SLC39A14-15434M | Recombinant Mouse SLC39A14 Protein | +Inquiry |
RFL15702PF | Recombinant Full Length Pongo Abelii Zinc Transporter Zip14(Slc39A14) Protein, His-Tagged | +Inquiry |
SLC39A14-681H | Recombinant Human SLC39A14 Protein | +Inquiry |
RFL2265HF | Recombinant Full Length Human Zinc Transporter Zip14(Slc39A14) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SLC39A14 Products
Required fields are marked with *
My Review for All SLC39A14 Products
Required fields are marked with *
0
Inquiry Basket