Recombinant Human SLC39A14 protein, His-tagged

Cat.No. : SLC39A14-4564H
Product Overview : Recombinant Human SLC39A14 protein(Q15043)(31-157aa), fused with C-terminal His tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 31-157a.a.
Tag : His
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 20.8 kDa
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : SSLGAPAISAASFLQDLIHRYGEGDSLTLQQLKALLNHLDVGVGRGNVTQHVQGHRNLSTCFSSGDLFTAHNFSEQSRIGSSELQEFCPTILQQLDSRACTSENQENEENEQTEEGRPSAVEVWGYG
Gene Name SLC39A14 solute carrier family 39 (zinc transporter), member 14 [ Homo sapiens ]
Official Symbol SLC39A14
Synonyms SLC39A14; solute carrier family 39 (zinc transporter), member 14; solute carrier family 39 (metal ion transporter), member 14; zinc transporter ZIP14; KIAA0062; NET34; ZIP14; ZIP-14; Zrt-, Irt-like protein 14; zrt- and Irt-like protein 14; solute carrier family 39 member 14; LIV-1 subfamily of ZIP zinc transporter 4; cig19; LZT-Hs4;
Gene ID 23516
mRNA Refseq NM_001128431
Protein Refseq NP_001121903
MIM 608736
UniProt ID Q15043

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLC39A14 Products

Required fields are marked with *

My Review for All SLC39A14 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon