Recombinant Human SLC39A6 protein, His-tagged
Cat.No. : | SLC39A6-2834H |
Product Overview : | Recombinant Human SLC39A6 protein(101-283 aa), fused to His tag, was expressed in E. coli. |
Availability | August 22, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 101-283 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | HLLPHSHASHHHSHSHEEPAMEMKRGPLFSHLSSQNIEESAYFDSTWKGLTALGGLYFMFLVEHVLTLIKQFKDKKKKNQKKPENDDDVEIKKQLSKYESQLSTNEEKVDTDDRTEGYLRADSQEPSHFDSQQPAVLEEEEVMIAHAHPQEVYNEYVPRGCKNKCHSHFHDTLGQSDDLIHHH |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | SLC39A6 solute carrier family 39 (zinc transporter), member 6 [ Homo sapiens ] |
Official Symbol | SLC39A6 |
Synonyms | LIV-1 |
Gene ID | 25800 |
mRNA Refseq | NM_012319.3 |
Protein Refseq | NP_036451.3 |
MIM | 608731 |
UniProt ID | Q13433 |
◆ Recombinant Proteins | ||
SLC39A6-2172C | Active Recombinant Cynomolgus SLC39A6 protein, His & Avi-tagged, Biotinylated | +Inquiry |
RFL25103MF | Recombinant Full Length Mouse Zinc Transporter Zip6(Slc39A6) Protein, His-Tagged | +Inquiry |
SLC39A6-1947H | Recombinant Human SLC39A6 Full Length Transmembrane protein(Nanodisc) | +Inquiry |
SLC39A6-564H | Recombinant Human SLC39A6 protein, His-tagged | +Inquiry |
SLC39A6-217Z | Recombinant Zebrafish SLC39A6 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC39A6 Products
Required fields are marked with *
My Review for All SLC39A6 Products
Required fields are marked with *