Recombinant Human SLC39A8 protein, GST-tagged

Cat.No. : SLC39A8-1878H
Product Overview : Recombinant Human SLC39A8 protein(18-143 aa), fused to GST tag, was expressed in E. coli.
Availability December 15, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 18-143 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : LGGVAEGPGLAFSEDVLSVFGANLSLSAAQLQHLLEQMGAASRVGVPEPGQLHFNQCLTAEEIFSLHGFSNATQITSSKFSVICPAVLQQLNFHPCEDRPKHKTRPSHSEVWGYGFLSVTIINLAS
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name SLC39A8 solute carrier family 39 (zinc transporter), member 8 [ Homo sapiens ]
Official Symbol SLC39A8
Synonyms SLC39A8; solute carrier family 39 (zinc transporter), member 8; solute carrier family 39 (metal ion transporter), member 8; zinc transporter ZIP8; BIGM103; ZIP-8; Zrt- and Irt-like protein 8; solute carrier family 39 member 8; LIV-1 subfamily of ZIP zinc transporter 6; BCG induced integral membrane protein BIGM103; BCG-induced integral membrane protein in monocyte clone 103 protein; ZIP8; PP3105; LZT-Hs6;
Gene ID 64116
mRNA Refseq NM_001135146
Protein Refseq NP_001128618
MIM 608732
UniProt ID Q9C0K1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLC39A8 Products

Required fields are marked with *

My Review for All SLC39A8 Products

Required fields are marked with *

0
cart-icon
0
compare icon