Recombinant Human SLC39A8 protein, GST-tagged
| Cat.No. : | SLC39A8-1878H |
| Product Overview : | Recombinant Human SLC39A8 protein(18-143 aa), fused to GST tag, was expressed in E. coli. |
| Availability | February 02, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 18-143 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | LGGVAEGPGLAFSEDVLSVFGANLSLSAAQLQHLLEQMGAASRVGVPEPGQLHFNQCLTAEEIFSLHGFSNATQITSSKFSVICPAVLQQLNFHPCEDRPKHKTRPSHSEVWGYGFLSVTIINLAS |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | SLC39A8 solute carrier family 39 (zinc transporter), member 8 [ Homo sapiens ] |
| Official Symbol | SLC39A8 |
| Synonyms | SLC39A8; solute carrier family 39 (zinc transporter), member 8; solute carrier family 39 (metal ion transporter), member 8; zinc transporter ZIP8; BIGM103; ZIP-8; Zrt- and Irt-like protein 8; solute carrier family 39 member 8; LIV-1 subfamily of ZIP zinc transporter 6; BCG induced integral membrane protein BIGM103; BCG-induced integral membrane protein in monocyte clone 103 protein; ZIP8; PP3105; LZT-Hs6; |
| Gene ID | 64116 |
| mRNA Refseq | NM_001135146 |
| Protein Refseq | NP_001128618 |
| MIM | 608732 |
| UniProt ID | Q9C0K1 |
| ◆ Recombinant Proteins | ||
| SLC39A8-5535R | Recombinant Rat SLC39A8 Protein | +Inquiry |
| SLC39A8-6817HF | Recombinant Full Length Human SLC39A8 Protein, GST-tagged | +Inquiry |
| SLC39A8-5194R | Recombinant Rat SLC39A8 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SLC39A8-671H | Recombinant Human SLC39A8 Protein, GST-tagged | +Inquiry |
| SLC39A8-8370M | Recombinant Mouse SLC39A8 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC39A8 Products
Required fields are marked with *
My Review for All SLC39A8 Products
Required fields are marked with *
