Recombinant Human SLC43A1 Protein, GST-tagged

Species :	Human
Source :	E.coli
Tag :	GST
Protein Length :	221-301 aa
Form :	The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.0). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AASequence :	AFPAPEEVNYTKKIKLSGLALDHKVTGDLFYTHVTTMGQRLSQKAPSLEDGSDAFMSPQDVRGTSENLPERSVPLRKSLCS
Purity :	85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage :	Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution :	Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.

Gene Name	SLC43A1 solute carrier family 43, member 1 [ Homo sapiens ]
Official Symbol	SLC43A1
Synonyms	SLC43A1; solute carrier family 43, member 1; POV1, prostate cancer overexpressed gene 1; large neutral amino acids transporter small subunit 3; PB39; R00504; L-type amino acid transporter 3; prostate cancer overexpressed gene 1 protein; LAT3; POV1;
Gene ID	8501
mRNA Refseq	NM_001198810
Protein Refseq	NP_001185739
MIM	603733
UniProt ID	O75387