Recombinant Human SLC43A1 Protein, GST-tagged
| Cat.No. : | SLC43A1-10H |
| Product Overview : | Recombinant Human SLC43A1 Protein(221-301 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 221-301 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.0). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AASequence : | AFPAPEEVNYTKKIKLSGLALDHKVTGDLFYTHVTTMGQRLSQKAPSLEDGSDAFMSPQDVRGTSENLPERSVPLRKSLCS |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| Gene Name | SLC43A1 solute carrier family 43, member 1 [ Homo sapiens ] |
| Official Symbol | SLC43A1 |
| Synonyms | SLC43A1; solute carrier family 43, member 1; POV1, prostate cancer overexpressed gene 1; large neutral amino acids transporter small subunit 3; PB39; R00504; L-type amino acid transporter 3; prostate cancer overexpressed gene 1 protein; LAT3; POV1; |
| Gene ID | 8501 |
| mRNA Refseq | NM_001198810 |
| Protein Refseq | NP_001185739 |
| MIM | 603733 |
| UniProt ID | O75387 |
| ◆ Recombinant Proteins | ||
| SLC43A1-10H | Recombinant Human SLC43A1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC43A1 Products
Required fields are marked with *
My Review for All SLC43A1 Products
Required fields are marked with *



