Recombinant Human SLC4A1 protein, His-tagged
Cat.No. : | SLC4A1-3717H |
Product Overview : | Recombinant Human SLC4A1 protein(1-200 aa), fused to His tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-200 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MEELQDDYEDMMEENLEQEEYEDPDIPESQMEEPAAHDTEATATDYHTTSHPGTHKVYVELQELVMDEKNQELRWMEAARWVQLEENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFIFEDQIRPQDREELLRALLLKHSHAGELEALGGVKPAVLTRSGDPSQPLLPQHSSLETQLF |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | SLC4A1 solute carrier family 4, anion exchanger, member 1 (erythrocyte membrane protein band 3, Diego blood group) [ Homo sapiens ] |
Official Symbol | SLC4A1 |
Synonyms | SLC4A1; solute carrier family 4, anion exchanger, member 1 (erythrocyte membrane protein band 3, Diego blood group); AE1, DI, EPB3, Waldner blood group , WD; band 3 anion transport protein; CD233; FR; Froese blood group; RTA1A; SW; Swann blood group; WR; Wright blood group; anion exchanger 1; anion exchanger-1; Waldner blood group; anion exchange protein 1; erythroid anion exchange protein; erythrocyte membrane protein band 3; solute carrier family 4, anion exchanger, number 1; DI; WD; AE1; WD1; BND3; EPB3; EMPB3; MGC116750; MGC116753; MGC126619; MGC126623; |
Gene ID | 6521 |
mRNA Refseq | NM_000342 |
Protein Refseq | NP_000333 |
UniProt ID | P02730 |
◆ Recombinant Proteins | ||
SLC4A1-3500H | Recombinant Human SLC4A1 protein, His-SUMO & Myc-tagged | +Inquiry |
Slc4a1-1794R | Recombinant Rat Slc4a1 protein, His-tagged | +Inquiry |
SLC4A1-26065TH | Recombinant Human SLC4A1 | +Inquiry |
SLC4A1-3717H | Recombinant Human SLC4A1 protein, His-tagged | +Inquiry |
SLC4A1-89HFL | Recombinant Full Length Human SLC4A1 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC4A1-1635HCL | Recombinant Human SLC4A1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SLC4A1 Products
Required fields are marked with *
My Review for All SLC4A1 Products
Required fields are marked with *
0
Inquiry Basket