Recombinant Human SLC6A4 protein, GST-tagged

• Cat.No.: SLC6A4-2322H
• Product Overview: Recombinant Human SLC6A4(1 a.a. - 630 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1-630 a.a.
• Description: This gene encodes an integral membrane protein that transports the neurotransmitter serotonin from synaptic spaces into presynaptic neurons. The encoded protein terminates the action of serotonin and recycles it in a sodium-dependent manner. This protein is a target of psychomotor stimulants, such as amphetamines and cocaine, and is a member of the sodium:neurotransmitter symporter family. A repeat length polymorphism in the promoter of this gene has been shown to affect the rate of serotonin uptake and may play a role in sudden infant death syndrome, aggressive behavior in Alzheimer disease patients, and depression-susceptibility in people experiencing emotional trauma.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 96.7 kDa
• AA Sequence: METTPLNSQKQLSACEDGEDCQENGVLQKVVPTPGDKVESGQISNGYSAVPSPGAGDDTRHSIPATTTTLVAELHQGERETWGKKVDFLLSVIGYAVDLGNVWRFPYICYQNGGGAFLLPYTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTIMAWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIILSVLLVRGATLPGAWRGVLFYLKPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQDALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPASTFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITCFFGSLVTLTFGGAYVVKLLEEYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRICWVAISPLFLLFIICSFLMSPPQLRLFQYNYPYWSIILGYCIGTSSFICIPTYIAYRLIITPGTFKERIIKSITPETPTEIPCGDIRLNAV
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: SLC6A4 solute carrier family 6 (neurotransmitter transporter, serotonin), member 4 [ Homo sapiens ]
• Official Symbol: SLC6A4
• Synonyms: SLC6A4; solute carrier family 6 (neurotransmitter transporter, serotonin), member 4; HTT; sodium-dependent serotonin transporter; 5 HTT; SERT1; 5HT transporter; 5-hydroxytryptamine transporter; solute carrier family 6 member 4; Na+/Cl- dependent serotonin transporter; 5HTT; OCD1; SERT; 5-HTT; hSERT; 5-HTTLPR
• Gene ID: 6532
• mRNA Refseq: NM_001045
• Protein Refseq: NP_001036
• MIM: 182138
• UniProt ID: P31645
• Chromosome Location: 17q11.2
• Pathway: Monoamine Transport, organism-specific biosystem; SIDS Susceptibility Pathways, organism-specific biosystem; Serotonergic synapse, organism-specific biosystem
• Function: Rab GTPase binding; actin filament binding; cocaine binding; monoamine transmembrane transporter activity; myosin binding; nitric-oxide synthase binding; protein binding; protein homodimerization activity; serotonin transmembrane transporter activity; serotonin transmembrane transporter activity; serotonin:sodium symporter activity; serotonin:sodium symporter activity; symporter activity; syntaxin-1 binding