Recombinant Human SLC6A4 protein, GST-tagged
Cat.No. : | SLC6A4-2322H |
Product Overview : | Recombinant Human SLC6A4(1 a.a. - 630 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-630 a.a. |
Description : | This gene encodes an integral membrane protein that transports the neurotransmitter serotonin from synaptic spaces into presynaptic neurons. The encoded protein terminates the action of serotonin and recycles it in a sodium-dependent manner. This protein is a target of psychomotor stimulants, such as amphetamines and cocaine, and is a member of the sodium:neurotransmitter symporter family. A repeat length polymorphism in the promoter of this gene has been shown to affect the rate of serotonin uptake and may play a role in sudden infant death syndrome, aggressive behavior in Alzheimer disease patients, and depression-susceptibility in people experiencing emotional trauma. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 96.7 kDa |
AA Sequence : | METTPLNSQKQLSACEDGEDCQENGVLQKVVPTPGDKVESGQISNGYSAVPSPGAGDDTRHSIPATTTTLVAELHQGERETWGKKVDFLLSVIGYAVDLGNVWRFPYICYQNGGGAFLLPYTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTIMAWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIILSVLLVRGATLPGAWRGVLFYLKPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQDALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPASTFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITCFFGSLVTLTFGGAYVVKLLEEYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRICWVAISPLFLLFIICSFLMSPPQLRLFQYNYPYWSIILGYCIGTSSFICIPTYIAYRLIITPGTFKERIIKSITPETPTEIPCGDIRLNAV |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | SLC6A4 solute carrier family 6 (neurotransmitter transporter, serotonin), member 4 [ Homo sapiens ] |
Official Symbol | SLC6A4 |
Synonyms | SLC6A4; solute carrier family 6 (neurotransmitter transporter, serotonin), member 4; HTT; sodium-dependent serotonin transporter; 5 HTT; SERT1; 5HT transporter; 5-hydroxytryptamine transporter; solute carrier family 6 member 4; Na+/Cl- dependent serotonin transporter; 5HTT; OCD1; SERT; 5-HTT; hSERT; 5-HTTLPR; |
Gene ID | 6532 |
mRNA Refseq | NM_001045 |
Protein Refseq | NP_001036 |
MIM | 182138 |
UniProt ID | P31645 |
Chromosome Location | 17q11.2 |
Pathway | Monoamine Transport, organism-specific biosystem; SIDS Susceptibility Pathways, organism-specific biosystem; Serotonergic synapse, organism-specific biosystem; |
Function | Rab GTPase binding; actin filament binding; cocaine binding; monoamine transmembrane transporter activity; myosin binding; nitric-oxide synthase binding; protein binding; protein homodimerization activity; serotonin transmembrane transporter activity; serotonin transmembrane transporter activity; serotonin:sodium symporter activity; serotonin:sodium symporter activity; symporter activity; syntaxin-1 binding; |
◆ Recombinant Proteins | ||
SLC6A4-680C | Recombinant Cynomolgus Monkey SLC6A4 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC6A4-4306R | Recombinant Rhesus monkey SLC6A4 Protein, His-tagged | +Inquiry |
Slc6a4-1197M | Recombinant Mouse Slc6a4 Protein, MYC/DDK-tagged | +Inquiry |
SLC6A4-6307H | Recombinant Human SLC6A4 Protein (Ala181-Ser252), N-GST tagged | +Inquiry |
SLC6A4-695HF | Recombinant Full Length Human SLC6A4 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC6A4-1638HCL | Recombinant Human SLC6A4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SLC6A4 Products
Required fields are marked with *
My Review for All SLC6A4 Products
Required fields are marked with *
0
Inquiry Basket