Recombinant Human SLC6A9 Protein, GST-tagged
Cat.No. : | SLC6A9-26H |
Product Overview : | Recombinant Human SLC6A9 Protein(209-285 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 209-285 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | SSMTHVLPWAYCNNPWNTHDCAGVLDASNLTNGSRPAALPSNLSHLLNHSLQRTSPSEEYWRLYVLKLSDDIGNFGE |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | SLC6A9 |
Synonyms | SLC6A9; solute carrier family 6 (neurotransmitter transporter, glycine), member 9; sodium- and chloride-dependent glycine transporter 1; GLYT1; glyT-1; solute carrier family 6 member 9; DKFZp547A1118; |
Gene ID | 6536 |
mRNA Refseq | NM_001024845 |
Protein Refseq | NP_001020016 |
MIM | 601019 |
UniProt ID | P48067 |
◆ Recombinant Proteins | ||
SLC6A9-5231R | Recombinant Rat SLC6A9 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC6A9-5572R | Recombinant Rat SLC6A9 Protein | +Inquiry |
SLC6A9-8416M | Recombinant Mouse SLC6A9 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC6A9-3213Z | Recombinant Zebrafish SLC6A9 | +Inquiry |
SLC6A9-15509M | Recombinant Mouse SLC6A9 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC6A9-1701HCL | Recombinant Human SLC6A9 293 Cell Lysate | +Inquiry |
SLC6A9-1702HCL | Recombinant Human SLC6A9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC6A9 Products
Required fields are marked with *
My Review for All SLC6A9 Products
Required fields are marked with *
0
Inquiry Basket