Recombinant Human SLC6A9 Protein, GST-tagged

Cat.No. : SLC6A9-26H
Product Overview : Recombinant Human SLC6A9 Protein(209-285 aa), fused with N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 209-285 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
AA Sequence : SSMTHVLPWAYCNNPWNTHDCAGVLDASNLTNGSRPAALPSNLSHLLNHSLQRTSPSEEYWRLYVLKLSDDIGNFGE
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Official Symbol SLC6A9
Synonyms SLC6A9; solute carrier family 6 (neurotransmitter transporter, glycine), member 9; sodium- and chloride-dependent glycine transporter 1; GLYT1; glyT-1; solute carrier family 6 member 9; DKFZp547A1118;
Gene ID 6536
mRNA Refseq NM_001024845
Protein Refseq NP_001020016
MIM 601019
UniProt ID P48067

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLC6A9 Products

Required fields are marked with *

My Review for All SLC6A9 Products

Required fields are marked with *

0
cart-icon