Recombinant Human SLC7A5 protein, GST-tagged
Cat.No. : | SLC7A5-301594H |
Product Overview : | Recombinant Human SLC7A5 (1-58 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Ile58 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MAGAGPKRRALAAPAAEEKEEAREKMLAAKSADGSAPAGEGEGVTLQRNITLLNGVAI |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | SLC7A5 solute carrier family 7 (amino acid transporter light chain, L system), member 5 [ Homo sapiens ] |
Official Symbol | SLC7A5 |
Synonyms | SLC7A5; solute carrier family 7 (amino acid transporter light chain, L system), member 5; large neutral amino acids transporter small subunit 1; CD98; D16S469E; E16; LAT1; MPE16; 4F2 LC; 4F2 light chain; CD98 light chain; integral membrane protein E16; L-type amino acid transporter 1; solute carrier family 7 member 5; large neutral amino acids transporter 1; y+ system cationic amino acid transporter; sodium-independent neutral amino acid transporter LAT1; solute carrier family 7 (cationic amino acid transporter, y+ system), member 5; 4F2LC; hLAT1; |
Gene ID | 8140 |
mRNA Refseq | NM_003486 |
Protein Refseq | NP_003477 |
MIM | 600182 |
UniProt ID | Q01650 |
◆ Recombinant Proteins | ||
SLC7A5-4561H | Recombinant Human SLC7A5 protein, His-SUMO&Myc-tagged | +Inquiry |
SLC7A5-5236R | Recombinant Rat SLC7A5 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC7A5-2292C | Recombinant Chicken SLC7A5 | +Inquiry |
SLC7A5-4893HCL | Recombinant Human SLC7A5 Over-expression cell lysate | +Inquiry |
SLC7A5-5577R | Recombinant Rat SLC7A5 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC7A5 Products
Required fields are marked with *
My Review for All SLC7A5 Products
Required fields are marked with *
0
Inquiry Basket