Recombinant Human SLC7A5 protein, GST-tagged

Cat.No. : SLC7A5-301594H
Product Overview : Recombinant Human SLC7A5 (1-58 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Met1-Ile58
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : MAGAGPKRRALAAPAAEEKEEAREKMLAAKSADGSAPAGEGEGVTLQRNITLLNGVAI
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name SLC7A5 solute carrier family 7 (amino acid transporter light chain, L system), member 5 [ Homo sapiens ]
Official Symbol SLC7A5
Synonyms SLC7A5; solute carrier family 7 (amino acid transporter light chain, L system), member 5; large neutral amino acids transporter small subunit 1; CD98; D16S469E; E16; LAT1; MPE16; 4F2 LC; 4F2 light chain; CD98 light chain; integral membrane protein E16; L-type amino acid transporter 1; solute carrier family 7 member 5; large neutral amino acids transporter 1; y+ system cationic amino acid transporter; sodium-independent neutral amino acid transporter LAT1; solute carrier family 7 (cationic amino acid transporter, y+ system), member 5; 4F2LC; hLAT1;
Gene ID 8140
mRNA Refseq NM_003486
Protein Refseq NP_003477
MIM 600182
UniProt ID Q01650

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLC7A5 Products

Required fields are marked with *

My Review for All SLC7A5 Products

Required fields are marked with *

0
cart-icon
0
compare icon