Recombinant Human SLC7A5 protein, His-SUMO&Myc-tagged
Cat.No. : | SLC7A5-4561H |
Product Overview : | Recombinant Human SLC7A5 protein(Q01650)(16-50aa), fused to N-terminal His tag and SUMO tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
Source : | E. coli |
Species : | Human |
Tag : | His-SUMO&Myc |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 19.7 kDa |
Protein length : | 16-50aa |
AA Sequence : | AEEKEEAREKMLAAKSADGSAPAGEGEGVTLQRNI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name : | SLC7A5 solute carrier family 7 (amino acid transporter light chain, L system), member 5 [ Homo sapiens ] |
Official Symbol : | SLC7A5 |
Synonyms : | SLC7A5; solute carrier family 7 (amino acid transporter light chain, L system), member 5; large neutral amino acids transporter small subunit 1; CD98; D16S469E; E16; LAT1; MPE16; 4F2 LC; 4F2 light chain; CD98 light chain; integral membrane protein E16; L-type amino acid transporter 1; solute carrier family 7 member 5; large neutral amino acids transporter 1; y+ system cationic amino acid transporter; sodium-independent neutral amino acid transporter LAT1; solute carrier family 7 (cationic amino acid transporter, y+ system), member 5; 4F2LC; hLAT1; |
Gene ID : | 8140 |
mRNA Refseq : | NM_003486 |
Protein Refseq : | NP_003477 |
MIM : | 600182 |
UniProt ID : | Q01650 |
Products Types
◆ Recombinant Protein | ||
SLC7A5-1256H | Recombinant Human SLC7A5 Protein (A2-T507), 8×His-MBP, Flag tagged | +Inquiry |
SLC7A5-5236R | Recombinant Rat SLC7A5 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC7A5-8423M | Recombinant Mouse SLC7A5 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC7A5-4562H | Recombinant Human SLC7A5 protein, His-SUMO&Myc-tagged | +Inquiry |
SLC7A5-4893HCL | Recombinant Human SLC7A5 Over-ex<x>pression cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket