Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human SLC7A5 protein, His-SUMO&Myc-tagged

Cat.No. : SLC7A5-4561H
Product Overview : Recombinant Human SLC7A5 protein(Q01650)(16-50aa), fused to N-terminal His tag and SUMO tag and C-terminal Myc tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
Source : E. coli
Species : Human
Tag : His-SUMO&Myc
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 19.7 kDa
Protein length : 16-50aa
AA Sequence : AEEKEEAREKMLAAKSADGSAPAGEGEGVTLQRNI
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name : SLC7A5 solute carrier family 7 (amino acid transporter light chain, L system), member 5 [ Homo sapiens ]
Official Symbol : SLC7A5
Synonyms : SLC7A5; solute carrier family 7 (amino acid transporter light chain, L system), member 5; large neutral amino acids transporter small subunit 1; CD98; D16S469E; E16; LAT1; MPE16; 4F2 LC; 4F2 light chain; CD98 light chain; integral membrane protein E16; L-type amino acid transporter 1; solute carrier family 7 member 5; large neutral amino acids transporter 1; y+ system cationic amino acid transporter; sodium-independent neutral amino acid transporter LAT1; solute carrier family 7 (cationic amino acid transporter, y+ system), member 5; 4F2LC; hLAT1;
Gene ID : 8140
mRNA Refseq : NM_003486
Protein Refseq : NP_003477
MIM : 600182
UniProt ID : Q01650

Products Types

◆ Recombinant Protein
SLC7A5-1256H Recombinant Human SLC7A5 Protein (A2-T507), 8×His-MBP, Flag tagged +Inquiry
SLC7A5-5236R Recombinant Rat SLC7A5 Protein, His (Fc)-Avi-tagged +Inquiry
SLC7A5-8423M Recombinant Mouse SLC7A5 Protein, His (Fc)-Avi-tagged +Inquiry
SLC7A5-4562H Recombinant Human SLC7A5 protein, His-SUMO&Myc-tagged +Inquiry
SLC7A5-4893HCL Recombinant Human SLC7A5 Over-ex<x>pression cell lysate +Inquiry

See All SLC7A5 Recombinant Protein

Related Gene

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends