Recombinant Human SLC7A5 protein, His-SUMO&Myc-tagged
Cat.No. : | SLC7A5-4561H |
Product Overview : | Recombinant Human SLC7A5 protein(Q01650)(16-50aa), fused to N-terminal His tag and SUMO tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc&SUMO |
Protein Length : | 16-50aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 19.7 kDa |
AA Sequence : | AEEKEEAREKMLAAKSADGSAPAGEGEGVTLQRNI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | SLC7A5 solute carrier family 7 (amino acid transporter light chain, L system), member 5 [ Homo sapiens ] |
Official Symbol | SLC7A5 |
Synonyms | SLC7A5; solute carrier family 7 (amino acid transporter light chain, L system), member 5; large neutral amino acids transporter small subunit 1; CD98; D16S469E; E16; LAT1; MPE16; 4F2 LC; 4F2 light chain; CD98 light chain; integral membrane protein E16; L-type amino acid transporter 1; solute carrier family 7 member 5; large neutral amino acids transporter 1; y+ system cationic amino acid transporter; sodium-independent neutral amino acid transporter LAT1; solute carrier family 7 (cationic amino acid transporter, y+ system), member 5; 4F2LC; hLAT1; |
Gene ID | 8140 |
mRNA Refseq | NM_003486 |
Protein Refseq | NP_003477 |
MIM | 600182 |
UniProt ID | Q01650 |
◆ Recombinant Proteins | ||
SLC7A5-6867Z | Recombinant Zebrafish SLC7A5 | +Inquiry |
SLC7A5-4562H | Recombinant Human SLC7A5 protein, His-SUMO&Myc-tagged | +Inquiry |
SLC7A5-15519M | Recombinant Mouse SLC7A5 Protein | +Inquiry |
SLC7A5-1256H | Recombinant Human SLC7A5 Protein (A2-T507), 8×His-MBP, Flag tagged | +Inquiry |
SLC7A5-2292C | Recombinant Chicken SLC7A5 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC7A5 Products
Required fields are marked with *
My Review for All SLC7A5 Products
Required fields are marked with *