Recombinant Human SLC7A5 protein, His-SUMO&Myc-tagged

• Cat.No.: SLC7A5-4562H
• Product Overview: Recombinant Human SLC7A5 protein(Q01650)(16-50aa), fused to N-terminal His tag and SUMO tag and C-terminal Myc tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&Myc&SUMO
• Protein Length: 16-50aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 18.0 kDa
• AA Sequence: AEEKEEAREKMLAAKSADGSAPAGEGEGVTLQRNI
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: SLC7A5 solute carrier family 7 (amino acid transporter light chain, L system), member 5 [ Homo sapiens ]
• Official Symbol: SLC7A5
• Synonyms: SLC7A5; solute carrier family 7 (amino acid transporter light chain, L system), member 5; large neutral amino acids transporter small subunit 1; CD98; D16S469E; E16; LAT1; MPE16; 4F2 LC; 4F2 light chain; CD98 light chain; integral membrane protein E16; L-type amino acid transporter 1; solute carrier family 7 member 5; large neutral amino acids transporter 1; y+ system cationic amino acid transporter; sodium-independent neutral amino acid transporter LAT1; solute carrier family 7 (cationic amino acid transporter, y+ system), member 5; 4F2LC; hLAT1
• Gene ID: 8140
• mRNA Refseq: NM_003486
• Protein Refseq: NP_003477
• MIM: 600182
• UniProt ID: Q01650