Recombinant Human SLCO2B1 protein, His&Myc-tagged
Cat.No. : | SLCO2B1-3502H |
Product Overview : | Recombinant Human SLCO2B1 protein(O94956)(461-564aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 461-564aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 18.4 kDa |
AA Sequence : | FFIGCSSHQIAGITHQTSAHPGLELSPSCMEACSCPLDGFNPVCDPSTRVEYITPCHAGCSSWVVQDALDNSQVFYTNCSCVVEGNPVLAGSCDSTCSHLVVPF |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | SLCO2B1 solute carrier organic anion transporter family, member 2B1 [ Homo sapiens ] |
Official Symbol | SLCO2B1 |
Synonyms | SLCO2B1; solute carrier organic anion transporter family, member 2B1; SLC21A9, solute carrier family 21 (organic anion transporter), member 9; solute carrier organic anion transporter family member 2B1; OATP B; OATP2B1; OATP-RP2; organic anion transporter B; organic anion transporter polypeptide-related protein 2; solute carrier family 21 (organic anion transporter), member 9; OATPB; OATP-B; SLC21A9; KIAA0880; DKFZp686E0517; |
Gene ID | 11309 |
mRNA Refseq | NM_001145211 |
Protein Refseq | NP_001138683 |
MIM | 604988 |
UniProt ID | O94956 |
◆ Recombinant Proteins | ||
SLCO2B1-5519H | Recombinant Human SLCO2B1 protein, His-tagged | +Inquiry |
SLCO2B1-5256R | Recombinant Rat SLCO2B1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLCO2B1-5520H | Recombinant Human SLCO2B1 protein, His-Myc-tagged | +Inquiry |
SLCO2B1-3573Z | Recombinant Zebrafish SLCO2B1 | +Inquiry |
SLCO2B1-3502H | Recombinant Human SLCO2B1 protein, His&Myc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLCO2B1 Products
Required fields are marked with *
My Review for All SLCO2B1 Products
Required fields are marked with *