Recombinant Human SLCO2B1 protein, His&Myc-tagged

Cat.No. : SLCO2B1-3502H
Product Overview : Recombinant Human SLCO2B1 protein(O94956)(461-564aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&Myc
Protein Length : 461-564aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 18.4 kDa
AA Sequence : FFIGCSSHQIAGITHQTSAHPGLELSPSCMEACSCPLDGFNPVCDPSTRVEYITPCHAGCSSWVVQDALDNSQVFYTNCSCVVEGNPVLAGSCDSTCSHLVVPF
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name SLCO2B1 solute carrier organic anion transporter family, member 2B1 [ Homo sapiens ]
Official Symbol SLCO2B1
Synonyms SLCO2B1; solute carrier organic anion transporter family, member 2B1; SLC21A9, solute carrier family 21 (organic anion transporter), member 9; solute carrier organic anion transporter family member 2B1; OATP B; OATP2B1; OATP-RP2; organic anion transporter B; organic anion transporter polypeptide-related protein 2; solute carrier family 21 (organic anion transporter), member 9; OATPB; OATP-B; SLC21A9; KIAA0880; DKFZp686E0517;
Gene ID 11309
mRNA Refseq NM_001145211
Protein Refseq NP_001138683
MIM 604988
UniProt ID O94956

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLCO2B1 Products

Required fields are marked with *

My Review for All SLCO2B1 Products

Required fields are marked with *

0
cart-icon