Recombinant Human SLIT3 protein, His-tagged
Cat.No. : | SLIT3-754H |
Product Overview : | Recombinant Human SLIT3 protein(O75094)(34-155aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 34-155aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 17.9 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | CPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRG |
Gene Name | SLIT3 slit homolog 3 (Drosophila) [ Homo sapiens ] |
Official Symbol | SLIT3 |
Synonyms | SLIT3; slit homolog 3 (Drosophila); SLIL2, slit (Drosophila) homolog 3; slit homolog 3 protein; MEGF5; Slit 3; SLIT1; slit2; multiple EGF-like domains protein 5; multiple epidermal growth factor-like domains protein 5; SLIL2; Slit-3; FLJ10764; |
Gene ID | 6586 |
mRNA Refseq | NM_003062 |
Protein Refseq | NP_003053 |
MIM | 603745 |
UniProt ID | O75094 |
◆ Recombinant Proteins | ||
SLIT3-754H | Recombinant Human SLIT3 protein, His-tagged | +Inquiry |
Slit3-7992R | Recombinant Rat Slit3 protein, His & S-tagged | +Inquiry |
SLIT3-4543C | Recombinant Chimpanzee SLIT3 protein, His&Myc-tagged | +Inquiry |
SLIT3-4087H | Recombinant Human SLIT3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Slit3-36M | Recombinant Mouse Slit3 protein, His/S-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLIT3 Products
Required fields are marked with *
My Review for All SLIT3 Products
Required fields are marked with *
0
Inquiry Basket