Recombinant Human SLIT3 protein, His-tagged

Cat.No. : SLIT3-754H
Product Overview : Recombinant Human SLIT3 protein(O75094)(34-155aa), fused with N-terminal His tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 34-155aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 17.9 kDa
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : CPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRG
Gene Name SLIT3 slit homolog 3 (Drosophila) [ Homo sapiens ]
Official Symbol SLIT3
Synonyms SLIT3; slit homolog 3 (Drosophila); SLIL2, slit (Drosophila) homolog 3; slit homolog 3 protein; MEGF5; Slit 3; SLIT1; slit2; multiple EGF-like domains protein 5; multiple epidermal growth factor-like domains protein 5; SLIL2; Slit-3; FLJ10764;
Gene ID 6586
mRNA Refseq NM_003062
Protein Refseq NP_003053
MIM 603745
UniProt ID O75094

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLIT3 Products

Required fields are marked with *

My Review for All SLIT3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon