Recombinant Human SMARCA4, GST-tagged
Cat.No. : | SMARCA4-1916H |
Product Overview : | Recombinant Human SMARCA4(a.a. 1480-1603), fused with N-terminal GST-tag, was expressed in an E. coli expression system. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1480-1603 |
Description : | The protein encoded by this gene is a member of the SWI/SNF family of proteins and is similar to the brahma protein of Drosophila. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI, which is required for transcriptional activation of genes normally repressed by chromatin. In addition, this protein can bind BRCA1, as well as regulate the expression of the tumorigenic protein CD44. Mutations in this gene cause rhabdoid tumor predisposition syndrome type 2. Multiple transcript variants encoding different isoforms have been found for this gene. |
Form : | 40 mM Tris-HCl, pH 8.0,110 mM NaCl, 2.2 mM KCl, and 20% glycerol. |
Molecular Mass : | 41.3 kDa |
AA Sequence : | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRY IADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHV THPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLE VLFQGPLGSAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDSE |
Purity : | ≥96% |
Applications : | Useful for the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. |
Storage : | >6 months at –80°C. Avoid freeze/thaw cycles. |
Concentration : | 2.88 mg/ml |
Gene Name | SMARCA4 SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 [ Homo sapiens (human) ] |
Official Symbol | SMARCA4 |
Synonyms | SMARCA4; SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4; SNF2L4; transcription activator BRG1; ATP dependent helicase SMARCA4; BAF190; brahma protein like 1; BRG1; BRM/SWI2 related gene 1; FLJ39786; global transcription activator homologous sequence; homeotic gene regulator; hSNF2b; mitotic growth and transcription activator; nuclear protein GRB1; SNF2; SNF2 BETA; SNF2 like 4; SNF2LB; sucrose nonfermenting like 4; SWI2; BAF190A; SNF2-like 4; protein BRG-1; brahma protein-like 1; BRM/SWI2-related gene 1; protein brahma homolog 1; BRG1-associated factor 190A; sucrose nonfermenting-like 4; ATP-dependent helicase SMARCA4; SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 4; RTPS2; SNF2-BETA |
Gene ID | 6597 |
mRNA Refseq | NM_001128849 |
Protein Refseq | NP_001122321 |
MIM | 603254 |
UniProt ID | P51532 |
Chromosome Location | 19p13.2 |
Pathway | Chromatin modifying enzymes; Chromatin organization; Integrated Breast Cancer Pathway; RMTs methylate histone arginines |
Function | ATP binding; DNA-dependent ATPase activity; contributes_to RNA polymerase II core promoter proximal region sequence-specific DNA binding |
◆ Recombinant Proteins | ||
SMARCA4-198H | Recombinant Human SMARCA4 Protein, His-tagged | +Inquiry |
SMARCA4-2804H | Recombinant Human SMARCA4, GST-tagged | +Inquiry |
SMARCA4-27675TH | Recombinant Human SMARCA4, His-tagged | +Inquiry |
SMARCA4-2861H | Recombinant Human SMARCA4 protein, GST-tagged | +Inquiry |
SMARCA4-197H | Recombinant Human SMARCA4 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SMARCA4 Products
Required fields are marked with *
My Review for All SMARCA4 Products
Required fields are marked with *
0
Inquiry Basket