Recombinant Human SMARCA4 protein(808-1092aa), His-tagged
Cat.No. : | SMARCA4-22H |
Product Overview : | Recombinant Human SMARCA4 protein(808-1092aa)(P51532), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 808-1092aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 37.1kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | IIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLDRILPKL |
Gene Name | SMARCA4 SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 [ Homo sapiens ] |
Official Symbol | SMARCA4 |
Synonyms | SMARCA4; SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4; SNF2L4; transcription activator BRG1; ATP dependent helicase SMARCA4; BAF190; brahma protein like 1; BRG1; BRM/SWI2 related gene 1; FLJ39786; global transcription activator homologous sequence; homeotic gene regulator; hSNF2b; mitotic growth and transcription activator; nuclear protein GRB1; SNF2; SNF2 BETA; SNF2 like 4; SNF2LB; sucrose nonfermenting like 4; SWI2; BAF190A; SNF2-like 4; protein BRG-1; brahma protein-like 1; BRM/SWI2-related gene 1; protein brahma homolog 1; BRG1-associated factor 190A; sucrose nonfermenting-like 4; ATP-dependent helicase SMARCA4; SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 4; RTPS2; SNF2-BETA |
Gene ID | 6597 |
mRNA Refseq | NM_001128844 |
Protein Refseq | NP_001122316 |
MIM | 603254 |
UniProt ID | P51532 |
◆ Recombinant Proteins | ||
SMARCA4-197H | Recombinant Human SMARCA4 Protein, His-tagged | +Inquiry |
SMARCA4-1910H | Recombinant Human SMARCA4, GST-tagged | +Inquiry |
SMARCA4-05H | Recombinant Human SMARCA4 Protein (658-1328), N-FLAG tagged | +Inquiry |
SMARCA4-22H | Recombinant Human SMARCA4 protein(808-1092aa), His-tagged | +Inquiry |
SMARCA4-21H | Recombinant Human SMARCA4 protein(700-1246aa), MBP&His-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SMARCA4 Products
Required fields are marked with *
My Review for All SMARCA4 Products
Required fields are marked with *
0
Inquiry Basket