Recombinant Human SMARCA4 protein(808-1092aa), His-tagged

Cat.No. : SMARCA4-22H
Product Overview : Recombinant Human SMARCA4 protein(808-1092aa)(P51532), fused with N-terminal His tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 808-1092aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 37.1kDa
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : IIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLDRILPKL
Gene Name SMARCA4 SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 [ Homo sapiens ]
Official Symbol SMARCA4
Synonyms SMARCA4; SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4; SNF2L4; transcription activator BRG1; ATP dependent helicase SMARCA4; BAF190; brahma protein like 1; BRG1; BRM/SWI2 related gene 1; FLJ39786; global transcription activator homologous sequence; homeotic gene regulator; hSNF2b; mitotic growth and transcription activator; nuclear protein GRB1; SNF2; SNF2 BETA; SNF2 like 4; SNF2LB; sucrose nonfermenting like 4; SWI2; BAF190A; SNF2-like 4; protein BRG-1; brahma protein-like 1; BRM/SWI2-related gene 1; protein brahma homolog 1; BRG1-associated factor 190A; sucrose nonfermenting-like 4; ATP-dependent helicase SMARCA4; SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 4; RTPS2; SNF2-BETA
Gene ID 6597
mRNA Refseq NM_001128844
Protein Refseq NP_001122316
MIM 603254
UniProt ID P51532

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SMARCA4 Products

Required fields are marked with *

My Review for All SMARCA4 Products

Required fields are marked with *

0
cart-icon