Recombinant Human SMARCD3 protein, GST-tagged
Cat.No. : | SMARCD3-1205H |
Product Overview : | Recombinant Human SMARCD3 protein(1-88 aa), fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-88 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | MTPGLQHPPTVVQRPGMPSGARMPHQGAPMGPPGSPYMGSPAVRPGLAPAGMEPARKRAAPPPGQSQAQSQGQPVPTAPARSRSAKRR |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | SMARCD3 SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3 [ Homo sapiens ] |
Official Symbol | SMARCD3 |
Synonyms | SMARCD3; SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3; SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3; 60kDa BRG 1/Brm associated factor subunit c; BAF60C; CRACD3; mammalian chromatin remodeling complex BRG1 associated factor 60C; Rsc6p; SWI/SNF complex 60 kDa subunit C; Swp73 like protein; Swp73-like protein; BRG1-associated factor 60C; chromatin remodeling complex BAF60C subunit; 60 kDa BRG-1/Brm-associated factor subunit C; mammalian chromatin remodeling complex BRG1-associated factor 60C; SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3, isoform 1; MGC111010; |
Gene ID | 6604 |
mRNA Refseq | NM_001003801 |
Protein Refseq | NP_001003801 |
MIM | 601737 |
UniProt ID | Q6STE5 |
◆ Recombinant Proteins | ||
SMARCD3-15606M | Recombinant Mouse SMARCD3 Protein | +Inquiry |
SMARCD3-702H | Recombinant Human SMARCD3 Protein, His-tagged | +Inquiry |
SMARCD3-8467M | Recombinant Mouse SMARCD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
SMARCD3-4338R | Recombinant Rhesus monkey SMARCD3 Protein, His-tagged | +Inquiry |
SMARCD3-703H | Recombinant Human SMARCD3 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SMARCD3 Products
Required fields are marked with *
My Review for All SMARCD3 Products
Required fields are marked with *