Recombinant Human SMARCD3 protein, GST-tagged

Cat.No. : SMARCD3-1205H
Product Overview : Recombinant Human SMARCD3 protein(1-88 aa), fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-88 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : MTPGLQHPPTVVQRPGMPSGARMPHQGAPMGPPGSPYMGSPAVRPGLAPAGMEPARKRAAPPPGQSQAQSQGQPVPTAPARSRSAKRR
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name SMARCD3 SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3 [ Homo sapiens ]
Official Symbol SMARCD3
Synonyms SMARCD3; SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3; SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3; 60kDa BRG 1/Brm associated factor subunit c; BAF60C; CRACD3; mammalian chromatin remodeling complex BRG1 associated factor 60C; Rsc6p; SWI/SNF complex 60 kDa subunit C; Swp73 like protein; Swp73-like protein; BRG1-associated factor 60C; chromatin remodeling complex BAF60C subunit; 60 kDa BRG-1/Brm-associated factor subunit C; mammalian chromatin remodeling complex BRG1-associated factor 60C; SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3, isoform 1; MGC111010;
Gene ID 6604
mRNA Refseq NM_001003801
Protein Refseq NP_001003801
MIM 601737
UniProt ID Q6STE5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SMARCD3 Products

Required fields are marked with *

My Review for All SMARCD3 Products

Required fields are marked with *

0
cart-icon