Recombinant Human SMCO1 Protein, GST-tagged

Cat.No. : SMCO1-5243H
Product Overview : Human C3orf43 full-length ORF (BAG53982.1, 1 a.a. - 214 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : SMCO1 (Single-Pass Membrane Protein With Coiled-Coil Domains 1) is a Protein Coding gene.
Molecular Mass : 51 kDa
AA Sequence : MNNETTTLISLKEAMKRVDHKLQALETQFKELDFTKDNLMQKFEHHSKALASQAAQDEMWTAVRALQLTSMELNILYSYVIEVLICLHTRVLEKLPDLVRGLPTLASVLRRKVKNKRVRVVWESILEECGLQEGDITALCTFFIARGNKAEHYTAKVRQMYIRDVTFLITNMVKNQALQDSLLRAVQVIEKGKAVRTPEKQKSSLEELIPSVKN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name SMCO1 single-pass membrane protein with coiled-coil domains 1 [ Homo sapiens (human) ]
Official Symbol SMCO1
Synonyms SMCO1; single-pass membrane protein with coiled-coil domains 1; Single-Pass Membrane Protein With Coiled-Coil Domains 1; C3orf43; Single-Pass Membrane And Coiled-Coil Domain-Containing Protein 1; Chromosome 3 Open Reading Frame 43; single-pass membrane and coiled-coil domain-containing protein 1
Gene ID 255798
mRNA Refseq NM_001077657
Protein Refseq NP_001071125
UniProt ID Q147U7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SMCO1 Products

Required fields are marked with *

My Review for All SMCO1 Products

Required fields are marked with *

0
cart-icon