Recombinant Human SMCO1 Protein, GST-tagged
Cat.No. : | SMCO1-5243H |
Product Overview : | Human C3orf43 full-length ORF (BAG53982.1, 1 a.a. - 214 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | SMCO1 (Single-Pass Membrane Protein With Coiled-Coil Domains 1) is a Protein Coding gene. |
Molecular Mass : | 51 kDa |
AA Sequence : | MNNETTTLISLKEAMKRVDHKLQALETQFKELDFTKDNLMQKFEHHSKALASQAAQDEMWTAVRALQLTSMELNILYSYVIEVLICLHTRVLEKLPDLVRGLPTLASVLRRKVKNKRVRVVWESILEECGLQEGDITALCTFFIARGNKAEHYTAKVRQMYIRDVTFLITNMVKNQALQDSLLRAVQVIEKGKAVRTPEKQKSSLEELIPSVKN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | SMCO1 single-pass membrane protein with coiled-coil domains 1 [ Homo sapiens (human) ] |
Official Symbol | SMCO1 |
Synonyms | SMCO1; single-pass membrane protein with coiled-coil domains 1; Single-Pass Membrane Protein With Coiled-Coil Domains 1; C3orf43; Single-Pass Membrane And Coiled-Coil Domain-Containing Protein 1; Chromosome 3 Open Reading Frame 43; single-pass membrane and coiled-coil domain-containing protein 1 |
Gene ID | 255798 |
mRNA Refseq | NM_001077657 |
Protein Refseq | NP_001071125 |
UniProt ID | Q147U7 |
◆ Recombinant Proteins | ||
RFL29780MF | Recombinant Full Length Mouse Uncharacterized Protein C3Orf43 Homolog Protein, His-Tagged | +Inquiry |
SMCO1-5243H | Recombinant Human SMCO1 Protein, GST-tagged | +Inquiry |
SMCO1-3902HF | Recombinant Full Length Human SMCO1 Protein, GST-tagged | +Inquiry |
SMCO1-1907H | Recombinant Human SMCO1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SMCO1-8043HCL | Recombinant Human C3orf43 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SMCO1 Products
Required fields are marked with *
My Review for All SMCO1 Products
Required fields are marked with *