Recombinant Human SMG7 protein, His-tagged
Cat.No. : | SMG7-3947H |
Product Overview : | Recombinant Human SMG7 protein(201-500 aa), fused to His tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 201-500 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | DHLTTIFYYCRSIAVKFPFPAASTNLQKALSKALESRDEVKTKWGVSDFIKAFIKFHGHVYLSKSLEKLSPLREKLEEQFKRLLFQKAFNSQQLVHVTVINLFQLHHLRDFSNETEQHTYSQDEQLCWTQLLALFMSFLGILCKCPLQNESQEESYNAYPLPAVKVSMDWLRLRPRVFQEAVVDERQYIWPWLISLLNSFHPHEEDLSSISATPLPEEFELQGFLALRPSFRNLDFSKGHQGITGDKEGQQRRIRQQRLISIGKWIADNQPRLIQCENEVGKLLFITEIPELILEDPSEA |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | SMG7 smg-7 homolog, nonsense mediated mRNA decay factor (C. elegans) [ Homo sapiens ] |
Official Symbol | SMG7 |
Synonyms | SMG7; smg-7 homolog, nonsense mediated mRNA decay factor (C. elegans); C1orf16, chromosome 1 open reading frame 16; protein SMG7; EST1 telomerase component homolog C (S. cerevisiae); EST1C; KIAA0250; SGA56M; SMG 7; EST1-like protein C; ever shorter telomeres 1C; EST1 telomerase component homolog C; breast cancer-associated antigen SGA-56M; C1orf16; FLJ23717; |
Gene ID | 9887 |
mRNA Refseq | NM_001174061 |
Protein Refseq | NP_001167532 |
MIM | 610964 |
UniProt ID | Q92540 |
◆ Recombinant Proteins | ||
SMG7-4134Z | Recombinant Zebrafish SMG7 | +Inquiry |
SMG7-3947H | Recombinant Human SMG7 protein, His-tagged | +Inquiry |
SMG7-15625M | Recombinant Mouse SMG7 Protein | +Inquiry |
SMG7-8480M | Recombinant Mouse SMG7 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SMG7 Products
Required fields are marked with *
My Review for All SMG7 Products
Required fields are marked with *
0
Inquiry Basket