Recombinant Human SMG7 protein, His-tagged

Cat.No. : SMG7-3947H
Product Overview : Recombinant Human SMG7 protein(201-500 aa), fused to His tag, was expressed in E. coli.
Availability August 30, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 201-500 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : DHLTTIFYYCRSIAVKFPFPAASTNLQKALSKALESRDEVKTKWGVSDFIKAFIKFHGHVYLSKSLEKLSPLREKLEEQFKRLLFQKAFNSQQLVHVTVINLFQLHHLRDFSNETEQHTYSQDEQLCWTQLLALFMSFLGILCKCPLQNESQEESYNAYPLPAVKVSMDWLRLRPRVFQEAVVDERQYIWPWLISLLNSFHPHEEDLSSISATPLPEEFELQGFLALRPSFRNLDFSKGHQGITGDKEGQQRRIRQQRLISIGKWIADNQPRLIQCENEVGKLLFITEIPELILEDPSEA
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name SMG7 smg-7 homolog, nonsense mediated mRNA decay factor (C. elegans) [ Homo sapiens ]
Official Symbol SMG7
Synonyms SMG7; smg-7 homolog, nonsense mediated mRNA decay factor (C. elegans); C1orf16, chromosome 1 open reading frame 16; protein SMG7; EST1 telomerase component homolog C (S. cerevisiae); EST1C; KIAA0250; SGA56M; SMG 7; EST1-like protein C; ever shorter telomeres 1C; EST1 telomerase component homolog C; breast cancer-associated antigen SGA-56M; C1orf16; FLJ23717;
Gene ID 9887
mRNA Refseq NM_001174061
Protein Refseq NP_001167532
MIM 610964
UniProt ID Q92540

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SMG7 Products

Required fields are marked with *

My Review for All SMG7 Products

Required fields are marked with *

0
cart-icon