Recombinant Human SMG7 protein, His-tagged

• Cat.No.: SMG7-3947H
• Product Overview: Recombinant Human SMG7 protein(201-500 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 201-500 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: DHLTTIFYYCRSIAVKFPFPAASTNLQKALSKALESRDEVKTKWGVSDFIKAFIKFHGHVYLSKSLEKLSPLREKLEEQFKRLLFQKAFNSQQLVHVTVINLFQLHHLRDFSNETEQHTYSQDEQLCWTQLLALFMSFLGILCKCPLQNESQEESYNAYPLPAVKVSMDWLRLRPRVFQEAVVDERQYIWPWLISLLNSFHPHEEDLSSISATPLPEEFELQGFLALRPSFRNLDFSKGHQGITGDKEGQQRRIRQQRLISIGKWIADNQPRLIQCENEVGKLLFITEIPELILEDPSEA
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: SMG7 smg-7 homolog, nonsense mediated mRNA decay factor (C. elegans) [ Homo sapiens ]
• Official Symbol: SMG7
• Synonyms: SMG7; smg-7 homolog, nonsense mediated mRNA decay factor (C. elegans); C1orf16, chromosome 1 open reading frame 16; protein SMG7; EST1 telomerase component homolog C (S. cerevisiae); EST1C; KIAA0250; SGA56M; SMG 7; EST1-like protein C; ever shorter telomeres 1C; EST1 telomerase component homolog C; breast cancer-associated antigen SGA-56M; C1orf16; FLJ23717
• Gene ID: 9887
• mRNA Refseq: NM_001174061
• Protein Refseq: NP_001167532
• MIM: 610964
• UniProt ID: Q92540