Recombinant Human SMIM11A Protein, GST-tagged
| Cat.No. : | SMIM11A-3719H |
| Product Overview : | Human FAM165B full-length ORF (AAH15596.1, 1 a.a. - 58 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | SMIM11A (Small Integral Membrane Protein 11A) is a Protein Coding gene. An important paralog of this gene is SMIM11B. |
| Molecular Mass : | 32.78 kDa |
| AA Sequence : | MNWKVLEHVPLLLYILAAKTLILCLTFAGVKMYQRKRLEAKQQKLEAERKKQSEKKDN |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | SMIM11A small integral membrane protein 11A [ Homo sapiens (human) ] |
| Official Symbol | SMIM11A |
| Synonyms | SMIM11A; small integral membrane protein 11A; Small Integral Membrane Protein 11A; Family With Sequence Similarity 165, Member B; Small Integral Membrane Protein 11; C21orf51; FAM165B; SMIM11; Chromosome 21 Open Reading Frame 51; Protein FAM165B; SMIM11B; small integral membrane protein 11A; family with sequence similarity 165, member B; protein FAM165B; small integral membrane protein 11 |
| Gene ID | 54065 |
| mRNA Refseq | NM_058182 |
| Protein Refseq | NP_478062 |
| UniProt ID | P58511 |
| ◆ Recombinant Proteins | ||
| SMIM11A-4532HF | Recombinant Full Length Human SMIM11A Protein, GST-tagged | +Inquiry |
| SMIM11A-3719H | Recombinant Human SMIM11A Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SMIM11A Products
Required fields are marked with *
My Review for All SMIM11A Products
Required fields are marked with *
