Recombinant Human SMO
| Cat.No. : | SMO-31423TH |
| Product Overview : | Recombinant fragment corresponding to amino acids 461-519 of Human Smoothened with an N terminal proprietary tag; Predicted MWt 32.12 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 59 amino acids |
| Description : | The protein encoded by this gene is a G protein-coupled receptor that interacts with the patched protein, a receptor for hedgehog proteins. The encoded protein tranduces signals to other proteins after activation by a hedgehog protein/patched protein complex. |
| Molecular Weight : | 32.120kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | GFVLITFSCHFYDFFNQAEWERSFRDYVLCQANVTIGLPTKQPIPDCEIKNRPSLLVEK |
| Sequence Similarities : | Belongs to the G-protein coupled receptor Fz/Smo family.Contains 1 FZ (frizzled) domain. |
| Gene Name | SMO smoothened, frizzled family receptor [ Homo sapiens ] |
| Official Symbol | SMO |
| Synonyms | SMO; smoothened, frizzled family receptor; SMOH, smoothened (Drosophila) homolog , smoothened homolog (Drosophila) , smoothened, seven transmembrane spanning receptor; smoothened homolog; frizzled family member 11; FZD11; |
| Gene ID | 6608 |
| mRNA Refseq | NM_005631 |
| Protein Refseq | NP_005622 |
| MIM | 601500 |
| Uniprot ID | Q99835 |
| Chromosome Location | 7q32.1 |
| Pathway | Basal cell carcinoma, organism-specific biosystem; Basal cell carcinoma, conserved biosystem; Class B/2 (Secretin family receptors), organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Other, organism-specific biosystem; |
| Function | G-protein coupled receptor activity; PDZ domain binding; Wnt-activated receptor activity; Wnt-protein binding; drug binding; |
| ◆ Recombinant Proteins | ||
| RFL18969RF | Recombinant Full Length Rat Smoothened Homolog(Smo) Protein, His-Tagged | +Inquiry |
| SMO-28H | Recombinant Human SMO Protein | +Inquiry |
| SMO-31423TH | Recombinant Human SMO | +Inquiry |
| RFL16147HF | Recombinant Full Length Human Smoothened Homolog(Smo) Protein, His-Tagged | +Inquiry |
| SMO-6780HF | Recombinant Full Length Human SMO Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SMO Products
Required fields are marked with *
My Review for All SMO Products
Required fields are marked with *



