Recombinant Human SMR3B Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SMR3B-4109H
Product Overview : SMR3B MS Standard C13 and N15-labeled recombinant protein (NP_006676) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : SMR3B (Submaxillary Gland Androgen Regulated Protein 3B) is a Protein Coding gene. Diseases associated with SMR3B include Schopf-Schulz-Passarge Syndrome and Retinitis Pigmentosa 10.
Molecular Mass : 8.2 kDa
AA Sequence : MKSLTWILGLWALAACFTPGESQRGPRGPYPPGPLAPPQPFGPGFVPPPPPPPYGPGRIPPPPPAPYGPGIFPPPPPQPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SMR3B submaxillary gland androgen regulated protein 3B [ Homo sapiens (human) ]
Official Symbol SMR3B
Synonyms SMR3B; submaxillary gland androgen regulated protein 3B; PROL3, proline rich 3, submaxillary gland androgen regulated protein 3 homolog B (mouse); submaxillary gland androgen-regulated protein 3B; P B; PRL3; proline rich 3; proline-rich protein 3; proline-rich peptide P-B; salivary proline-rich protein; submaxillary gland androgen regulated protein 3 homolog B; P-B; PBII; PROL3; SMR1B; MGC104379;
Gene ID 10879
mRNA Refseq NM_006685
Protein Refseq NP_006676
MIM 611593
UniProt ID P02814

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SMR3B Products

Required fields are marked with *

My Review for All SMR3B Products

Required fields are marked with *

0
cart-icon