Recombinant Human SMR3B protein, His-tagged

Cat.No. : SMR3B-3851H
Product Overview : Recombinant Human SMR3B protein(23-106 aa), fused to His tag, was expressed in E. coli.
Availability August 29, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 23-106 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : QRGPRGPYPPGPLAPPQPFGPGFVPPPPPPPYGPGRIPPPYSCTPNMNNCSRCHHHHKRHHYPCNYCFCYPKYEFQHCFQETFT
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name SMR3B submaxillary gland androgen regulated protein 3B [ Homo sapiens ]
Official Symbol SMR3B
Synonyms SMR3B; submaxillary gland androgen regulated protein 3B; PROL3, proline rich 3 , submaxillary gland androgen regulated protein 3 homolog B (mouse); submaxillary gland androgen-regulated protein 3B; P B; PRL3; proline rich 3; proline-rich protein 3; proline-rich peptide P-B; salivary proline-rich protein; submaxillary gland androgen regulated protein 3 homolog B; P-B; PBII; PROL3; SMR1B; MGC104379;
Gene ID 10879
mRNA Refseq NM_006685
Protein Refseq NP_006676
MIM 611593
UniProt ID P02814

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SMR3B Products

Required fields are marked with *

My Review for All SMR3B Products

Required fields are marked with *

0
cart-icon