Recombinant Human SMR3B protein, His-tagged

• Cat.No.: SMR3B-3851H
• Product Overview: Recombinant Human SMR3B protein(23-106 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 23-106 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: QRGPRGPYPPGPLAPPQPFGPGFVPPPPPPPYGPGRIPPPYSCTPNMNNCSRCHHHHKRHHYPCNYCFCYPKYEFQHCFQETFT
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: SMR3B submaxillary gland androgen regulated protein 3B [ Homo sapiens ]
• Official Symbol: SMR3B
• Synonyms: SMR3B; submaxillary gland androgen regulated protein 3B; PROL3, proline rich 3 , submaxillary gland androgen regulated protein 3 homolog B (mouse); submaxillary gland androgen-regulated protein 3B; P B; PRL3; proline rich 3; proline-rich protein 3; proline-rich peptide P-B; salivary proline-rich protein; submaxillary gland androgen regulated protein 3 homolog B; P-B; PBII; PROL3; SMR1B; MGC104379
• Gene ID: 10879
• mRNA Refseq: NM_006685
• Protein Refseq: NP_006676
• MIM: 611593
• UniProt ID: P02814