Recombinant Human SMR3B Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SMR3B-4109H
• Product Overview: SMR3B MS Standard C13 and N15-labeled recombinant protein (NP_006676) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: SMR3B (Submaxillary Gland Androgen Regulated Protein 3B) is a Protein Coding gene. Diseases associated with SMR3B include Schopf-Schulz-Passarge Syndrome and Retinitis Pigmentosa 10.
• Molecular Mass: 8.2 kDa
• AA Sequence: MKSLTWILGLWALAACFTPGESQRGPRGPYPPGPLAPPQPFGPGFVPPPPPPPYGPGRIPPPPPAPYGPGIFPPPPPQPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SMR3B submaxillary gland androgen regulated protein 3B [ Homo sapiens (human) ]
• Official Symbol: SMR3B
• Synonyms: SMR3B; submaxillary gland androgen regulated protein 3B; PROL3, proline rich 3, submaxillary gland androgen regulated protein 3 homolog B (mouse); submaxillary gland androgen-regulated protein 3B; P B; PRL3; proline rich 3; proline-rich protein 3; proline-rich peptide P-B; salivary proline-rich protein; submaxillary gland androgen regulated protein 3 homolog B; P-B; PBII; PROL3; SMR1B; MGC104379
• Gene ID: 10879
• mRNA Refseq: NM_006685
• Protein Refseq: NP_006676
• MIM: 611593
• UniProt ID: P02814