Recombinant Human SMR3B Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SMR3B-4109H |
Product Overview : | SMR3B MS Standard C13 and N15-labeled recombinant protein (NP_006676) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | SMR3B (Submaxillary Gland Androgen Regulated Protein 3B) is a Protein Coding gene. Diseases associated with SMR3B include Schopf-Schulz-Passarge Syndrome and Retinitis Pigmentosa 10. |
Molecular Mass : | 8.2 kDa |
AA Sequence : | MKSLTWILGLWALAACFTPGESQRGPRGPYPPGPLAPPQPFGPGFVPPPPPPPYGPGRIPPPPPAPYGPGIFPPPPPQPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SMR3B submaxillary gland androgen regulated protein 3B [ Homo sapiens (human) ] |
Official Symbol | SMR3B |
Synonyms | SMR3B; submaxillary gland androgen regulated protein 3B; PROL3, proline rich 3, submaxillary gland androgen regulated protein 3 homolog B (mouse); submaxillary gland androgen-regulated protein 3B; P B; PRL3; proline rich 3; proline-rich protein 3; proline-rich peptide P-B; salivary proline-rich protein; submaxillary gland androgen regulated protein 3 homolog B; P-B; PBII; PROL3; SMR1B; MGC104379; |
Gene ID | 10879 |
mRNA Refseq | NM_006685 |
Protein Refseq | NP_006676 |
MIM | 611593 |
UniProt ID | P02814 |
◆ Recombinant Proteins | ||
SMR3B-1100H | Recombinant Human SMR3B protein(Met1-Pro79), His-tagged | +Inquiry |
SMR3B-3851H | Recombinant Human SMR3B protein, His-tagged | +Inquiry |
SMR3B-4109H | Recombinant Human SMR3B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SMR3B-2158HFL | Recombinant Full Length Human SMR3B Protein, C-Flag-tagged | +Inquiry |
SMR3B-232H | Recombinant Human SMR3B, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SMR3B-910HCL | Recombinant Human SMR3B cell lysate | +Inquiry |
SMR3B-001HCL | Recombinant Human SMR3B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SMR3B Products
Required fields are marked with *
My Review for All SMR3B Products
Required fields are marked with *
0
Inquiry Basket